DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and TFS1

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_013279.1 Gene:TFS1 / 850875 SGDID:S000004168 Length:219 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:40/194 - (20%)
Similarity:79/194 - (40%) Gaps:50/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 KEMEVIPEILDE---PPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDW-------------NA 79
            |:..::.:::.:   .|..:|.::|.::..:..|.|....:.:.:|:..:             ||
Yeast    16 KKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQANA 80

  Fly    80 ---DPESFYTVLMICPDAPNRENPMYRSWLHWLVVNVPGLD-----------------IMKG-QP 123
               ..:..:|::|..||||::.:..:..:.|.:..::..|:                 ..|| ..
Yeast    81 YVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSNT 145

  Fly   124 ISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAG 187
            :.||.||.|||.||..||:.|:|:|...:|             .|.|..:|....:..|:|..|
Yeast   146 LIEYMGPAPPKGSGPHRYVFLLYKQPKGVD-------------SSKFSKIKDRPNWGYGTPATG 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 38/175 (22%)
TFS1NP_013279.1 PEBP_euk 36..216 CDD:176644 38/174 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I2241
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1641
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - otm46533
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
TreeFam 1 0.960 - -
98.920

Return to query results.
Submit another query.