DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and FT

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001320342.1 Gene:FT / 842859 AraportID:AT1G65480 Length:219 Species:Arabidopsis thaliana


Alignment Length:166 Identity:48/166 - (28%)
Similarity:85/166 - (51%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NVRRIMKEMEVIPEILDEPPREL-LRIKYDNTIDIEEGKTYTPTELKFQPRLD-WNADPESFYTV 87
            |:|..:....|:.::||...|.: |::.|... ::..|....|::::.:||:: ...|..:|||:
plant    48 NIRDPLIVSRVVGDVLDPFNRSITLKVTYGQR-EVTNGLDLRPSQVQNKPRVEIGGEDLRNFYTL 111

  Fly    88 LMICPDAPNRENPMYRSWLHWLVVNVPG-LDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDK 151
            :|:.||.|:..||..|.:|||||.::|. .....|..|..|..|.|  .:||.|.:.::::|..:
plant   112 VMVDPDVPSPSNPHLREYLHWLVTDIPATTGTTFGNEIVCYENPSP--TAGIHRVVFILFRQLGR 174

  Fly   152 LDFDEKKMELSNADG-HSNFDVMKFTQKYEMGSPVA 186
                    :...|.| ..||:..:|.:.|.:|.|||
plant   175 --------QTVYAPGWRQNFNTREFAEIYNLGLPVA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 42/144 (29%)
FTNP_001320342.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.