DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and E12A11

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_173250.1 Gene:E12A11 / 838390 AraportID:AT1G18100 Length:173 Species:Arabidopsis thaliana


Alignment Length:161 Identity:45/161 - (27%)
Similarity:81/161 - (50%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VIPEILDE-PPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRE 98
            ||.::||. .|...:.: |.....|..|....|:.....|:::.:...:..||::|..||||:..
plant    13 VIGDVLDMFIPTANMSV-YFGPKHITNGCEIKPSTAVNPPKVNISGHSDELYTLVMTDPDAPSPS 76

  Fly    99 NPMYRSWLHWLVVNVP-GLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELS 162
            .|..|.|:||:||::| |.:..:|:.|..|..|.||  .||.||::::::|:..:.     :.:.
plant    77 EPNMREWVHWIVVDIPGGTNPSRGKEILPYMEPRPP--VGIHRYILVLFRQNSPVG-----LMVQ 134

  Fly   163 NADGHSNFDVMKFTQKYEMGSPVAGNIFQSR 193
            .....:||....|...:::|.|||...|.::
plant   135 QPPSRANFSTRMFAGHFDLGLPVATVYFNAQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 40/145 (28%)
E12A11NP_173250.1 PEBP 6..173 CDD:412238 45/161 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.