DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and AT5G01300

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_195750.1 Gene:AT5G01300 / 830983 AraportID:AT5G01300 Length:162 Species:Arabidopsis thaliana


Alignment Length:144 Identity:37/144 - (25%)
Similarity:54/144 - (37%) Gaps:35/144 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TIDIEEGK---TYT----PTELKFQPRLDWNADPESFYTVLMICP--DAPNRENPMYRSWLHWLV 110
            ||| .:||   .||    ..:....|.|:|...||...|:.::..  |||:...|:. .|..|:|
plant    12 TID-NDGKLPRKYTMAGQGVKKDISPPLEWYNVPEGTKTLALVVEDIDAPDPSGPLV-PWTVWVV 74

  Fly   111 VNVPGLDIMKGQP---------------------ISEYFGPLPPKDSGIQRYLILVYQQSDKLDF 154
            |::|  ..|||.|                     |..:.|||.|......::.:.......|:..
plant    75 VDIP--PEMKGLPEGYSGNEDQTTGIREGNNDHKIPGWRGPLLPSHGHRFQFKLFALDDKPKIGH 137

  Fly   155 DEKKMELSNA-DGH 167
            ...|..|..| :||
plant   138 TVTKERLLIAIEGH 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 37/144 (26%)
AT5G01300NP_195750.1 PEBP_bact_arch 7..159 CDD:176643 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.