DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and Pbp2

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_083871.3 Gene:Pbp2 / 76400 MGIID:1923650 Length:187 Species:Mus musculus


Alignment Length:171 Identity:74/171 - (43%)
Similarity:106/171 - (61%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LDEPPRELLRIKYDNTIDIEE-GKTYTPTELKFQP-RLDWNA-DPESFYTVLMICPDAPNRENPM 101
            :||.|:.|||:.|... ::|| |:..|||::|.:| .:.|:. |....||:::..||||:|:.|:
Mouse    17 VDEQPQHLLRVTYTEA-EVEELGQVLTPTQVKHRPGSISWDGLDTGKLYTLILTDPDAPSRKKPV 80

  Fly   102 YRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADG 166
            ||.|.|:||||:.|.||..|..:|:|.|..|||.:|:.||:.|||||...|..||..:...:.|.
Mouse    81 YREWHHFLVVNMKGNDISSGNVLSDYVGSGPPKGTGLHRYVWLVYQQDKPLRCDEPILTNRSGDH 145

  Fly   167 HSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207
            ...|....|.:||.:|:||||..:|:.||.|||:|.|.|.|
Mouse   146 RGKFKTAAFRKKYHLGAPVAGTCYQAEWDSYVPKLYKQLSG 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 61/147 (41%)
Pbp2NP_083871.3 PEBP_euk 23..171 CDD:176644 61/148 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839407
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.720

Return to query results.
Submit another query.