DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and pebp1.2

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001016825.1 Gene:pebp1.2 / 549579 XenbaseID:XB-GENE-973798 Length:186 Species:Xenopus tropicalis


Alignment Length:169 Identity:67/169 - (39%)
Similarity:111/169 - (65%) Gaps:4/169 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LDEPPRELLRIKYDNTIDIEE-GKTYTPTELKFQP-RLDWNA-DPESFYTVLMICPDAPNRENPM 101
            ::|.|.:.|.:.| .::.|:| |:..|||:::.:| .::|.. |....||:::..||||:|:||.
 Frog    17 VEEKPAQPLLVTY-GSLGIDELGQVLTPTQVQSRPSSIEWEGMDSSKLYTLVLTDPDAPSRKNPK 80

  Fly   102 YRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADG 166
            :|.|.|:||||:.|.:|..|..:|:|.|..|||.:|:.||:.|||:|:::|...|:.:...:.:.
 Frog    81 FREWHHFLVVNMKGNNINSGCVLSDYVGSGPPKGTGLHRYVWLVYEQTEELKCTERVLCNRSGEH 145

  Fly   167 HSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205
            ...|.|..|.|||::|:|||||.:|:.||:|||:|.:.|
 Frog   146 RGMFKVASFRQKYKLGTPVAGNCYQAEWDDYVPKLYEQL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 57/147 (39%)
pebp1.2NP_001016825.1 PEBP_euk 24..171 CDD:176644 57/147 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.