DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and Pebp1

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_651051.1 Gene:Pebp1 / 42644 FlyBaseID:FBgn0038973 Length:176 Species:Drosophila melanogaster


Alignment Length:171 Identity:73/171 - (42%)
Similarity:115/171 - (67%) Gaps:1/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNREN 99
            :||:|:|..|.....|.|.:.:.:|.||..|||::|.||.:.::|:|.|.||:|::.||||:||:
  Fly     6 IIPDIIDVKPASKATITYPSGVQVELGKELTPTQVKDQPTVVFDAEPNSLYTILLVDPDAPSRED 70

  Fly   100 PMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNA 164
            |.:|..|||||:|:||..:.:||.|:||.|..|.:.:|:.||:.||::|:||:. .||.:..::.
  Fly    71 PKFRELLHWLVINIPGNKVSEGQTIAEYIGAGPREGTGLHRYVFLVFKQNDKIT-TEKFVSKTSR 134

  Fly   165 DGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205
            .|..|.....:.|||..|.|||||.||:::|:||..|::|:
  Fly   135 TGRINVKARDYIQKYSFGGPVAGNFFQAQYDDYVKTLIETV 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 62/144 (43%)
Pebp1NP_651051.1 PEBP_euk 20..162 CDD:176644 62/142 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452398
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.