DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and CG7054

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_651050.1 Gene:CG7054 / 42643 FlyBaseID:FBgn0038972 Length:179 Species:Drosophila melanogaster


Alignment Length:180 Identity:66/180 - (36%)
Similarity:113/180 - (62%) Gaps:9/180 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNA--DPESFYTVLMICPDAPN 96
            :::|::||..|...:::.|.:.:::::|...|||::|.||.:.|:.  ...:..|:||:.||||.
  Fly     3 DIVPDVLDAVPAGTIKVIYGDDLEVKQGNELTPTQVKDQPIVSWSGLEGKSNLLTLLMVDPDAPT 67

  Fly    97 RENPMYRSWLHWLVVNVPGL--DIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKM 159
            |::|.||..|||.|||:||.  :...|..:::|.|..||||:|:.||:.|:|:|.:|:   |:..
  Fly    68 RQDPKYREILHWSVVNIPGSNENPSGGHSLADYVGSGPPKDTGLHRYIFLLYRQENKI---EETP 129

  Fly   160 ELSNA--DGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207
            .:||.  .|..||:...|..|:.:|.|:|.|.:|:::|:|||...||:.|
  Fly   130 TISNTTRTGRLNFNARDFAAKHGLGEPIAANYYQAQYDDYVPIRNKTIVG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 54/150 (36%)
CG7054NP_651050.1 PEBP_euk 15..164 CDD:176644 54/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452399
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.