DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and CG17919

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_649644.1 Gene:CG17919 / 40780 FlyBaseID:FBgn0037433 Length:202 Species:Drosophila melanogaster


Alignment Length:191 Identity:75/191 - (39%)
Similarity:126/191 - (65%) Gaps:2/191 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 CLARSQDNDENVRRIMKEMEVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNA 79
            ||...|..  :|..:.:..:|:|:::.|||.:||::.|.|.:..::|...|||::|.||.::|:|
  Fly    11 CLLAVQAG--SVEEVFRSHQVVPDVIPEPPNQLLKVTYSNNLVAKDGVELTPTQVKDQPVVEWDA 73

  Fly    80 DPESFYTVLMICPDAPNRENPMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLIL 144
            .|..|||::|..||||:|..|.:|.:.||::.|:.|.|:..|:||:||.|..||:.:|:.||:.|
  Fly    74 QPGEFYTLIMTDPDAPSRAEPKFREFKHWILANIAGNDLASGEPIAEYIGSGPPQGTGLHRYVFL 138

  Fly   145 VYQQSDKLDFDEKKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205
            :|:||.||:|||:::...:......|...||...:|:|:|:||..:|:::|:|||:|.|.|
  Fly   139 LYKQSGKLEFDEERVSKRSRKDRPKFSAAKFAINHELGNPIAGTFYQAQYDDYVPKLHKQL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 58/144 (40%)
CG17919NP_649644.1 PEBP_euk 41..186 CDD:176644 58/144 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469060
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.