DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and CG10298

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_649643.1 Gene:CG10298 / 40779 FlyBaseID:FBgn0037432 Length:187 Species:Drosophila melanogaster


Alignment Length:174 Identity:76/174 - (43%)
Similarity:117/174 - (67%) Gaps:0/174 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRE 98
            :::|:||...|..||.:.|.....::.|...|||:::.||::.|:|||.:|||:|:..||||:|:
  Fly    12 KIVPDILKTCPATLLTVTYGGGQVVDVGGELTPTQVQSQPKVKWDADPNAFYTLLLTDPDAPSRK 76

  Fly    99 NPMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSN 163
            .|.:|.|.||||||:||..:..|..::||.|..||:.:|:.||:.||::|..||..:|.|:..::
  Fly    77 EPKFREWHHWLVVNIPGNQVENGVVLTEYVGAGPPQGTGLHRYVFLVFKQPQKLTCNEPKIPKTS 141

  Fly   164 ADGHSNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207
            .|..:||...||..||::|.|:|||.||::||:|||:|.|.|.|
  Fly   142 GDKRANFSTSKFMSKYKLGDPIAGNFFQAQWDDYVPKLYKQLSG 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 62/144 (43%)
CG10298NP_649643.1 PEBP_euk 24..170 CDD:176644 62/145 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469061
Domainoid 1 1.000 87 1.000 Domainoid score I2734
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2131
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D117065at6960
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 1 1.000 - - mtm963
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
109.900

Return to query results.
Submit another query.