DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and mRpL38

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_511152.2 Gene:mRpL38 / 32375 FlyBaseID:FBgn0030552 Length:416 Species:Drosophila melanogaster


Alignment Length:187 Identity:50/187 - (26%)
Similarity:86/187 - (45%) Gaps:25/187 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PRELLRIKY----DNTIDIEEGKTYTPTELKFQPRLDWN--ADP--------ESFYTVLMICPDA 94
            ||..|.|.|    |:...:..|....|||....|::|::  .||        ::::|::...|||
  Fly   144 PRVPLNISYQLDGDSLAPVYNGNVIKPTEAAKAPQIDFDGLVDPITGQAAGQDTYWTLVASNPDA 208

  Fly    95 PNRENPMYRSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKM 159
            ......  ...|||.:.|:|...:.:||.::||..|.||:..|.||.:.::|:|..:||..  ..
  Fly   209 HYTNGT--AECLHWFIANIPNGKVSEGQVLAEYLPPFPPRGVGYQRMVFVLYKQQARLDLG--SY 269

  Fly   160 ELSNADGHSNFDVMKFT------QKYEMGSPVAGNIFQSRWDEYVPELMKTLYGVSE 210
            :|:.|| :.|.:...|:      |..|..:|.....:|:.|||.:.:....:..:.|
  Fly   270 QLAAAD-YGNLEKRTFSTLDFYRQHQEQLTPAGLAFYQTNWDESLTQFYHDVLKIKE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 43/164 (26%)
mRpL38NP_511152.2 PEBP_euk 146..307 CDD:176644 43/165 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452385
Domainoid 1 1.000 44 1.000 Domainoid score I727
eggNOG 1 0.900 - - E1_COG1881
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11362
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.