DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and Mrpl38

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_001009369.2 Gene:Mrpl38 / 303685 RGDID:1311180 Length:380 Species:Rattus norvegicus


Alignment Length:177 Identity:51/177 - (28%)
Similarity:80/177 - (45%) Gaps:24/177 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LRIKY----DNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDA----PNRENPMYRS 104
            |.:.|    ::.|.:..|...||||....|.:.:.||.:|.:|:|.|..|.    |:.|      
  Rat   173 LHVAYALGEEDLIPVYHGNEVTPTEASQAPEVTYEADKDSLWTLLFINLDGHLLEPDAE------ 231

  Fly   105 WLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKK-----MELSNA 164
            :|||||.|:|...:.:||....|..|.|.:.||..|:..|:::|...::|.|..     .:|:  
  Rat   232 YLHWLVTNIPSNRVAEGQESCPYLPPFPARGSGFHRFAFLLFKQDKPINFSEDTRPSPCYQLA-- 294

  Fly   165 DGHSNFDVMKFTQKYEMGSPVAG-NIFQSRWDEYVPELMKTLYGVSE 210
              ...|..:.|.:|::.....|| ..||.|||:.|......|..:.|
  Rat   295 --QRTFHTLDFYKKHQEAMTPAGLAFFQCRWDDSVTHTFHQLLDMRE 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 44/157 (28%)
Mrpl38NP_001009369.2 PEBP_euk 171..321 CDD:176644 44/157 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.