DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and Y69E1A.5

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_502042.1 Gene:Y69E1A.5 / 190551 WormBaseID:WBGene00013477 Length:172 Species:Caenorhabditis elegans


Alignment Length:164 Identity:59/164 - (35%)
Similarity:91/164 - (55%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVIPEILDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDW---NADPESFYTVLMICPDAP 95
            |:.|:|::..|::.|.:.:|. |.:|.|.|.....||..||  |   .|||||.||||||.||..
 Worm    12 EITPKIIENAPKQKLHLCWDG-IQVEPGMTMQVRNLKNAPR--WALPGADPESIYTVLMIDPDNL 73

  Fly    96 NRENPMYRSWLHWLVVNVPGLDIMK----GQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDE 156
            :|:||....||||||.|:|..:|:.    ||....|..|.|...:.:.||:||:::.:.      
 Worm    74 SRKNPSVAEWLHWLVCNIPASNIIDGINGGQHQMAYGSPAPGPRTDLHRYVILMWEHAG------ 132

  Fly   157 KKMELSNADGHSNFDVMKFTQKYEMGSPVAGNIF 190
            :::.:......:.|:|.:|.:|.::|.|:|||.|
 Worm   133 RRISVPKPSSRAKFNVKQFIEKNKLGDPIAGNFF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 55/151 (36%)
Y69E1A.5NP_502042.1 PEBP_euk 25..168 CDD:176644 55/151 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.