DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and mrpl-38

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:NP_490808.1 Gene:mrpl-38 / 171682 WormBaseID:WBGene00021327 Length:413 Species:Caenorhabditis elegans


Alignment Length:155 Identity:38/155 - (24%)
Similarity:73/155 - (47%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LRIKYDNTIDIEEGKTYTPTELKFQPRLDWNA--DPESFYTVLMICPDAPNRENPMYRSWLHWLV 110
            |::.::|.|.:..|...|......:|.:...:  :...|.|:|||..|....:.......:.|::
 Worm   157 LQVNFENDIVVHSGNVITANSTLKRPEITIESVGNGGGFNTLLMINLDGNALDLGKNGEIVQWMI 221

  Fly   111 VNVP-GLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGHSNFDVMK 174
            .|:| |..|..|..|.:|..|||...:|..|...::::....:||   :::.::.|...: ::.|
 Worm   222 SNIPDGEAISAGSEIIDYLQPLPFYGTGYHRVAFVLFRHEKPVDF---QIQGNSLDTRIH-EISK 282

  Fly   175 FTQKYEMG-SPVAGNIFQSRWDEYV 198
            |.:|:|.. :|.|...||:.:|..|
 Worm   283 FYKKHEATITPSAIRFFQTSYDNSV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 35/147 (24%)
mrpl-38NP_490808.1 PEBP_euk 156..301 CDD:176644 35/147 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.