DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and pebp4

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_005170845.2 Gene:pebp4 / 101882266 -ID:- Length:194 Species:Danio rerio


Alignment Length:137 Identity:41/137 - (29%)
Similarity:72/137 - (52%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PTELKFQPRLDW--------NADPESFYTVLMICPDAPNRENPMYRSWLHWLVVNVPGLDI---- 118
            |...:.:..::|        :|:.|..||::|:.||||:|:||....|.|||:|::.|..:    
Zfish    54 PQRTREKISMEWGSPEVLLPHAEEEKKYTLVMVDPDAPSRQNPSRSYWRHWLLVDIKGEALQTGD 118

  Fly   119 MKGQPISEYFGPLPPKDSGIQRYLILVYQQSDK----LDFDEKKMELSNADGHSNFDVMKFTQKY 179
            ::|..:|.|..|.|||.:|:.||.|||::|.:.    |:.:|.:       ...|:|:..|.|::
Zfish   119 VRGTELSAYARPTPPKGTGLHRYQILVFEQPEGRTPFLNREENR-------SRGNWDLQAFIQRF 176

  Fly   180 EMGSPVA 186
            .:....|
Zfish   177 GLSGAKA 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 41/137 (30%)
pebp4XP_005170845.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.