DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and pebp1.1

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_002938131.1 Gene:pebp1.1 / 100497751 XenbaseID:XB-GENE-22069563 Length:185 Species:Xenopus tropicalis


Alignment Length:167 Identity:57/167 - (34%)
Similarity:99/167 - (59%) Gaps:1/167 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNA-DPESFYTVLMICPDAPNRENPMYR 103
            ::|.|:..|::.:.:....|.|:..|||:::..|.::|.: |....|||:...||.|:|:.....
 Frog    17 VEEQPKYPLKVAFGSVCVEELGQVLTPTQVQHCPNIEWESMDSSKLYTVIFTDPDVPSRKECHLG 81

  Fly   104 SWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGHS 168
            .|.|:|.|||.|.|:..|..::.|.|..|.|.:|:.||.||||:|:.::...|:.:..::|:...
 Frog    82 EWHHFLAVNVKGNDLSSGCILTAYVGSGPGKGTGLHRYTILVYEQAGRVQCTERILGNTSAEHRG 146

  Fly   169 NFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTL 205
            .|...:|.:||::.:|:||..||:.||::||:|.|.|
 Frog   147 KFKASEFRKKYKLAAPIAGTCFQAEWDDHVPKLYKQL 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 47/145 (32%)
pebp1.1XP_002938131.1 PEBP_euk 24..170 CDD:176644 47/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.