DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment a5 and pebp4

DIOPT Version :9

Sequence 1:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster
Sequence 2:XP_002932751.1 Gene:pebp4 / 100488878 XenbaseID:XB-GENE-941751 Length:202 Species:Xenopus tropicalis


Alignment Length:217 Identity:60/217 - (27%)
Similarity:98/217 - (45%) Gaps:56/217 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LPALHLLFL-GFICLARSQD---------NDENVRRIMKEMEV------------IPEILDEPPR 45
            ||.|.||.| ...|..::::         |||  :...|:::|            ||...|. ||
 Frog     6 LPLLALLSLAAHFCTLQAEECSIRKLFNANDE--KFCSKDLDVIYPDIGRVSCIYIPNCFDF-PR 67

  Fly    46 ELLRIKYDNTIDIEEGKTYTPTELKFQPRLDWNADPESFYTVLMICPDAPNRENPMYRSWLHWLV 110
            .|::: :|..:            |::.     .|.|...|.::|:.||||:|.:|.||.|.||::
 Frog    68 SLIKV-WDYPL------------LRYS-----KAQPGLKYVLIMVDPDAPSRWDPKYRYWRHWVL 114

  Fly   111 VNVPGLDIMKGQ-----PISEYFGPLPPKDSGIQRYLILVYQQS--DKLDFDEKKMELSNADGHS 168
            .::||..::.|:     .||.|..|.||..:|..||...:|:|.  ..|.|..:::.      .|
 Frog   115 TDIPGWQLLSGRDLTGNDISAYRRPSPPPGTGYHRYQFYLYEQPLWVILYFLPEEIR------RS 173

  Fly   169 NFDVMKFTQKYEMGSPVAGNIF 190
            .:|:..|.|:.::|.|||...|
 Frog   174 TWDLKAFVQRNKLGEPVATTQF 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 43/151 (28%)
pebp4XP_002932751.1 PEBP_euk 42..197 CDD:176644 50/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.