DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo3 and Dscam3

DIOPT Version :10

Sequence 1:NP_608592.2 Gene:robo3 / 33314 FlyBaseID:FBgn0041097 Length:1342 Species:Drosophila melanogaster
Sequence 2:NP_996226.2 Gene:Dscam3 / 42103 FlyBaseID:FBgn0261046 Length:2087 Species:Drosophila melanogaster


Alignment Length:1748 Identity:339/1748 - (19%)
Similarity:549/1748 - (31%) Gaps:555/1748 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PRIVEHPI-DTTVPRHEPATLNCKAEGSPTPTIQWYK--DGVPLKILPGSHRITLPAGGLFFLKV 84
            ||..:.|: :..|.|.....|.|..:|:|.|...||:  |...|..:|.|.|:.|..    .|.:
  Fly   246 PRTTQKPVMEIHVERGNDVHLPCNIQGNPFPIFTWYRVSDSAALYPIPSSQRVILSR----TLLL 306

  Fly    85 VNSRRETDAGIYWCEAKNELGVAR-----SRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAA 144
            :.:..|.|||.:.|:|.|:.|..|     |.|:.:.|.:|       ||...:..|.||...|..
  Fly   307 IKNADERDAGKWICQASNQFGEQRIEIRLSVNSYVSVHIL-------PQVQIVNSGGTANFNCTT 364

  Fly   145 PRGIPEPTVTWKKGGQKLDLE-----GSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRES 204
             .|.....:.|...|:.|...     |...:|.:...:|.:|:..:.|.|.|||:.:|.   |.|
  Fly   365 -TGSAIDAIDWLHNGKPLQANNALTTGRDNIRFLSKSSLLVQNVGRRDRGVYQCLVENQ---RAS 425

  Fly   205 --SLATLKV-HVKPYIIRGPHDQTVLEGASVTFPCRVGGDPMPDVLWL-------------RTAS 253
              ::|.||: ...|.:|....:|.|..|..::..|...|.|.|...||             |.|.
  Fly   426 AQAMAELKLGDTVPELIYTFIEQNVRPGPLISLKCSASGSPPPQFAWLLDSQPIMDVSLHHRFAI 490

  Fly   254 GG--NMPLDRVSVLEDRSLRLERVTIADEGEYSCEADNVVGAITAMGTLTVYAPPKFIQRPASKS 316
            |.  :|..|.:|     .|.:..|...|.|.|.|.|.|.:|::.....|.||.|| :::......
  Fly   491 GQFVDMSGDVIS-----HLNISHVRPDDGGLYKCVASNSMGSVQHSARLNVYGPP-YVRAIGPIK 549

  Fly   317 VELGADTSFECRAIGNPKPTIFW-------TIKNNSTL-------------IFPG---------- 351
            ...|.|....|...|.|...|.|       |..|:..|             :.||          
  Fly   550 AVAGEDIIVHCPFAGYPVEQIRWEKAHQELTTSNHYELASVADGGQLVIKNVEPGRDQGIYTCIV 614

  Fly   352 -----------------APP-LDRF-HSLNTEEG---------------------------HSIL 370
                             :|| ::.| ...|.:||                           .|.|
  Fly   615 RSRAGEEARRDMQLNVNSPPVIEPFKFPKNLQEGGRAQITCAVSSGDMPIYFSWKKDDSSIPSSL 679

  Fly   371 TLTRFQRTDKDLVIL------------CNAMNEVASITSRVQLSLDSQEDRPPPIIISGPVNQTL 423
            .:|..:.....|::.            |.|.|..|.:....:|.:     |..|.....|::..:
  Fly   680 QITEKKEEFYSLLVFKDISARHSGKYTCYASNAAAKVNYTAELQV-----RVAPRWRYEPMDTAI 739

  Fly   424 PIKSLATLQCKAIGLPSPTISWY----RDGIPVQPSSKLNITTSGDLIISDLDRQQDQGLYTCVA 484
            .:.:..::.|:|.|.|.|||:|:    :.....:|.|..|.:     ::.:|....|:|.|.|.|
  Fly   740 MLGNTISINCEAEGYPIPTITWFKGQGKGSKDFKPLSMRNHS-----LLLNLATDNDEGYYMCQA 799

  Fly   485 SSRAG---KSTWSGFLRIELPTNPNIKFYRAPEQTKCPSAPGQPKILNATASA---LTIVWPT-- 541
            ::..|   |.|      |.:..|...:|.::.....  |....|..|:..|..   :||.|..  
  Fly   800 TNEIGAGLKKT------IRINVNEPARFEQSARNIS--SRRNDPVTLDCHAKGDEPITIGWTQNN 856

  Fly   542 -----------------------------SDKAGASSFLGYSVEMYCTNQSRTWIPIASRLSEP- 576
                                         ||:..:..:...:...|...:...::.:..|...| 
  Fly   857 GRIDLNNFRFSIAEMKTEKGVDSQLTIGHSDRHDSGVYRCIAENPYGRAEQIIFLAVQERPDTPS 921

  Fly   577 ---IFTVESLT----------------------QGAAYMFIVRAENSLGFS-------------P 603
               ||.|.|.|                      |...|:   ::..||..:             |
  Fly   922 HLEIFEVGSRTVKLSWRRPFDGNSPVLSYLVQYQALKYL---QSHGSLAAAGGDWNGHVINVSLP 983

  Fly   604 PSPIS---------EPITAG---------KLVGVRDGSESTGTSQLLL-SDVETLLQANDVVELL 649
            .:.||         ..|.||         ::..:.:...|..|..::| :..|...:|...|::.
  Fly   984 STSISRSYDSDLRESAIVAGLTPATTFLIRMQAINEIERSAYTEAIVLKTQEEAPTEAPSNVQVQ 1048

  Fly   650 EANASD-----STTARLSWDIDSGQYIEGFYLYARELHSSEYKMVTLLN--------KGQGLSSC 701
            ....|:     ....|.||   :|:.| |:.:...| .......::::|        .|...:..
  Fly  1049 TGGESELIVTWQIPPRESW---NGELI-GYTVNCSE-EKQNINFISVVNSSLKSTIVSGWATTKA 1108

  Fly   702 TVPGLAKASTY--------EFFLVPFYKSIVGKPSNSRRMRTLEDVPEAPPYGMEAIQFNRTSVF 758
            |:.||.|.|.|        .|...|:..:|.|        .|.|.||||.|..:.....:..|:.
  Fly  1109 TLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFG--------TTAEGVPEAAPQNVNCTALSSQSLK 1165

  Fly   759 LKWLPPQPNRTRNGILTSYNV----VVKGLDVHNTTRIFKNMTIDAAAPTLLLANLTTGVTYYIA 819
            :.||.| |.:...||:..|.:    :|..:|......|.:...::....||..|:     .|.|.
  Fly  1166 ISWLEP-PLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRTSNLETYLHTLHKAS-----NYSIR 1224

  Fly   820 VAAATRVGVGPFSKPAVLRID-------------------------------------------- 840
            |.|.|..|.|..|.|...:.|                                            
  Fly  1225 VLAYTATGDGLASHPLFCQTDDDVPDAPAAIKAAALTADSILISWLTPKNRNGIISHYTVYSREA 1289

  Fly   841 -----ARTQSLDTGYTRYPI---SRDIADDFLTQTWFIVLLGSIIAIIVFLLGALVLFKRYQFIK 897
                 |:|..:......||:   ||.:|::.:.:.|...                          
  Fly  1290 GRKGQAKTHMVRVDENGYPVTFESRSLAENQMYEFWVSA-------------------------- 1328

  Fly   898 QTSLGSLHGNHAI--GTVRKFPTLPLNGG----GAVGAGGSNSTAAAGQ-SGHGLWI----DPTS 951
            .||:|.......|  .|..:.|....:.|    .|||.|......|.|. :....|:    ..|.
  Fly  1329 STSVGEGEPTSVIAQATNTRAPARIASFGQVVRKAVGTGLVLECLAVGNPTPRARWLTRDRPVTF 1393

  Fly   952 GVWRQAAGGGN---------PGGVGSCTTKEQLPG----YAQATAQQGQQPTLLPDYERLSPLNM 1003
            ..:.:....||         ..|..:||.......    |.....:....|.::..|.....:.:
  Fly  1394 SPFYEVTNEGNLKIHRVEGSLSGNYTCTANNLFGSDEIQYQVIAMKPPSAPQIIVQYASADSIRV 1458

  Fly  1004 PDYAEVACSTFKSPTHGAPPMGG-----GGGGQSASLYD-------------SCG-----AYATT 1045
                     ::.:|..|..|:.|     ...|:|.|:.:             .||     ..:..
  Fly  1459 ---------SWDAPDDGGAPLQGYTISYHTAGESWSITELLPENNAFTISGLKCGNQYIIKMSAH 1514

  Fly  1046 NVV-ANVKLYQNRYATKPNQSSGSNNN----------NHQGNDYQSTGMYSAPPSAHYGCLEPK- 1098
            |:| :.|...:....||...|...|.|          |.:.:.:|:.|.     |.|:..:|.: 
  Fly  1515 NMVGSGVASEEINVWTKGKASQAPNANELIATNATCVNLKLSSWQNGGC-----SIHHFSIEHRP 1574

  Fly  1099 -------------QQQQQQQPNLM----------------------TT-----STASTAILTNSP 1123
                         ...::.:.||:                      ||     ||.:...:|..|
  Fly  1575 LGDIRWTVVTSDISNAEENRENLIFCDFLPAKWYQLRISATNDAGKTTEHYHFSTTNIDGITIPP 1639

  Fly  1124 AKVKKINITENKMDQLEGKSERTNPFNQQ------QQLLLASNALKQGLGAYANTTLAAQMASGG 1182
            ..|..   :||  |.:......|||.:..      ..:::..:.:...|......||...:|.|.
  Fly  1640 PSVFP---SEN--DLMNNLINSTNPTSGDWFATLIVVVIITVSIITIALTIKHRRTLCGPIAEGY 1699

  Fly  1183 GAGTL----------RRQRQ------PKTLYKSENNIL-------------GKSGLRQNTMNASV 1218
            .:.||          ||.:|      .||:.|...:.:             |::|....|...:|
  Fly  1700 ESRTLPGDYKEDHENRRNQQVYSASPVKTVDKGNESEMYEISPYATFSVNGGRTGAPAKTPTRAV 1764

  Fly  1219 GA--PSNGQMDFLTGGPPSEGGDFSGLGLCNSTNQLLNDWASSASIAAPGDYHFGSKQPSKQHLY 1281
            .|  |.:..|.|.|.|.| ||.:.      |:|...|        :.:.|..|..||....:..|
  Fly  1765 AAQTPLDYTMQFKTFGHP-EGENL------NATAYPL--------LPSSGFGHVKSKSSWHKQRY 1814

  Fly  1282 VKAKDGTWSAVSSDAYQSFKHQQQHHPFLAGSGDNTKSLASVNSLAGDSKFLSSFGSS 1339
            ...:|   .:..|.:.......|..|...:..|.:.||.|:.:.:...|:..:|...|
  Fly  1815 YNTED---ESTLSKSMTIVAGSQAGHSKKSNGGRSAKSSAACSGVVAGSESDTSISPS 1869

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo3NP_608592.2 Ig 23..117 CDD:472250 30/101 (30%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 0/3 (0%)
Ig strand E 77..81 CDD:409353 0/3 (0%)
Ig strand F 95..100 CDD:409353 1/4 (25%)
Ig strand G 109..112 CDD:409353 1/2 (50%)
Ig 124..211 CDD:472250 24/93 (26%)
Ig strand B 138..142 CDD:409353 1/3 (33%)
Ig strand C 152..156 CDD:409353 0/3 (0%)
Ig strand E 176..180 CDD:409353 1/3 (33%)
Ig strand F 190..195 CDD:409353 3/4 (75%)
Ig strand G 204..207 CDD:409353 1/4 (25%)
Ig 218..302 CDD:472250 26/98 (27%)
Ig strand B 232..236 CDD:409353 0/3 (0%)
Ig strand C 245..249 CDD:409353 0/3 (0%)
Ig strand E 268..272 CDD:409353 1/3 (33%)
Ig strand F 282..287 CDD:409353 2/4 (50%)
Ig strand G 295..298 CDD:409353 0/2 (0%)
Ig 307..403 CDD:472250 27/183 (15%)
Ig strand B 323..327 CDD:409353 0/3 (0%)
Ig strand C 336..340 CDD:409353 2/10 (20%)
Ig strand E 366..372 CDD:409353 3/32 (9%)
Ig strand F 382..388 CDD:409353 2/17 (12%)
Ig strand G 396..399 CDD:409353 0/2 (0%)
Ig 413..497 CDD:472250 21/90 (23%)
Ig strand B 429..433 CDD:409353 0/3 (0%)
Ig strand C 442..446 CDD:409353 2/3 (67%)
Ig strand E 464..468 CDD:409353 0/3 (0%)
Ig strand F 479..484 CDD:409353 2/4 (50%)
Ig strand G 492..495 CDD:409353 1/2 (50%)
FN3 519..612 CDD:238020 24/174 (14%)
FN3 644..735 CDD:238020 21/111 (19%)
fn3 743..832 CDD:394996 22/92 (24%)
Dscam3NP_996226.2 Ig 38..135 CDD:472250
Ig strand B 56..60 CDD:409353
Ig strand C 69..73 CDD:409353
Ig strand E 93..97 CDD:409353
Ig strand F 113..118 CDD:409353
Ig strand G 126..130 CDD:409353
Ig 246..337 CDD:472250 28/94 (30%)
Ig strand B 264..268 CDD:409353 1/3 (33%)
Ig strand C 277..281 CDD:409353 0/3 (0%)
Ig strand E 303..307 CDD:409353 1/3 (33%)
Ig strand F 317..322 CDD:409353 1/4 (25%)
Ig strand G 330..333 CDD:409353 1/2 (50%)
Ig 341..434 CDD:472250 26/103 (25%)
Ig strand B 358..362 CDD:409353 1/3 (33%)
Ig strand C 371..375 CDD:409353 0/3 (0%)
Ig strand E 400..404 CDD:409353 1/3 (33%)
Ig strand F 414..419 CDD:409353 3/4 (75%)
Ig strand G 427..430 CDD:409353 0/2 (0%)
IgI_4_Dscam 439..536 CDD:409548 27/101 (27%)
Ig strand A' 447..451 CDD:409548 1/3 (33%)
Ig strand B 454..463 CDD:409548 1/8 (13%)
Ig strand C 468..474 CDD:409548 2/5 (40%)
Ig strand C' 476..479 CDD:409548 0/2 (0%)
Ig strand D 487..495 CDD:409548 3/7 (43%)
Ig strand E 499..508 CDD:409548 3/13 (23%)
Ig strand F 515..523 CDD:409548 4/7 (57%)
Ig strand G 526..536 CDD:409548 2/9 (22%)
Ig 539..630 CDD:472250 14/91 (15%)
Ig strand B 556..560 CDD:409353 0/3 (0%)
Ig strand C 569..573 CDD:409353 1/3 (33%)
Ig strand E 594..598 CDD:409353 0/3 (0%)
Ig strand F 609..614 CDD:409353 0/4 (0%)
Ig strand G 623..626 CDD:409353 0/2 (0%)
Ig 633..724 CDD:472250 15/90 (17%)
Ig strand B 651..655 CDD:409353 0/3 (0%)
Ig strand C 665..669 CDD:409353 0/3 (0%)
Ig strand E 690..694 CDD:409353 1/3 (33%)
Ig strand F 704..709 CDD:409353 1/4 (25%)
Ig strand G 717..720 CDD:409353 0/2 (0%)
Ig 728..815 CDD:472250 23/97 (24%)
Ig strand B 745..749 CDD:409353 0/3 (0%)
Ig strand C 758..762 CDD:409353 2/3 (67%)
Ig strand E 780..784 CDD:409353 0/8 (0%)
Ig strand F 794..799 CDD:409353 2/4 (50%)
Ig strand G 808..811 CDD:409353 2/8 (25%)
Ig 820..913 CDD:472250 11/94 (12%)
Ig strand C 849..853 CDD:409353 2/3 (67%)
Ig strand E 879..883 CDD:409353 0/3 (0%)
Ig strand F 893..898 CDD:409353 0/4 (0%)
Ig strand G 906..909 CDD:409353 0/2 (0%)
FN3 <940..1417 CDD:442628 92/524 (18%)
Ig 1355..1430 CDD:472250 14/74 (19%)
Ig strand B 1368..1372 CDD:409353 0/3 (0%)
Ig strand C 1381..1385 CDD:409353 0/3 (0%)
Ig strand E 1403..1407 CDD:409353 2/3 (67%)
Ig strand F 1417..1422 CDD:409353 1/4 (25%)
Ig strand G 1430..1433 CDD:409353 0/2 (0%)
FN3 1441..1530 CDD:238020 14/97 (14%)
FN3 1542..1620 CDD:238020 8/82 (10%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.