DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo3 and CG17839

DIOPT Version :10

Sequence 1:NP_608592.2 Gene:robo3 / 33314 FlyBaseID:FBgn0041097 Length:1342 Species:Drosophila melanogaster
Sequence 2:NP_996085.2 Gene:CG17839 / 39616 FlyBaseID:FBgn0036454 Length:1656 Species:Drosophila melanogaster


Alignment Length:601 Identity:133/601 - (22%)
Similarity:222/601 - (36%) Gaps:136/601 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 VGVRESSLAT----------LKVHVKPYIIRGPHDQTVLEGASVTFPCRVGGDPMPDV-LWLRTA 252
            ||.|..||.:          |...|.|..:. |.| .:.||.|:|..|...|:|.|.: |::   
  Fly  1008 VGERGDSLPSETLVAWTDPALPAFVDPPTVH-PAD-NIPEGGSMTILCLAFGNPAPTISLYV--- 1067

  Fly   253 SGGNMPLDRVSVLEDRSLRLERVTI-----ADEGEYSCEADNVVGA-ITAMGTLTVYAPPKFIQR 311
             ||::      |.:|.|..:  ||:     ||....||.|||..|. :.|...:.:..||| ||.
  Fly  1068 -GGHL------VRQDASRHM--VTVIHNVSADMEHVSCYADNGYGVPMQATRRVNICYPPK-IQA 1122

  Fly   312 PASKSVELGADTSFECRAIGNPKP-TIFWTIKNNSTLIFPGAPPLDRFHSLNTEEGH-SILTLT- 373
            .......:|.:....|.....|.| ||||..|:....:..|.   :.|.|:...|.. ||.|:: 
  Fly  1123 AGITVANIGDEIELRCTVDSKPAPKTIFWREKDGRVPVINGG---NYFISVKANESRPSIYTMSL 1184

  Fly   374 RFQRTDKDLV--ILCNAMNEVASITSRVQLSL--------------------------------- 403
            |..:...:.|  ..|:|.|...:.|:.|.:.:                                 
  Fly  1185 RISKLQANDVGDYFCHADNPFGATTTPVSVRIRNTPALNHNVSECCAAQNVSMACRSACSYYVDF 1249

  Fly   404 DSQEDRPPPIIISGPVNQTLPIKSLATLQCKAIG-----------LPSPTISWYRDGIPVQPSSK 457
            |:..|||..|:....:           ::|.|.|           :|...::|.| |..|: |.:
  Fly  1250 DAIADRPECIVDFDKL-----------MRCAADGSDHRSCCADEHVPRKCLNWCR-GESVR-SKE 1301

  Fly   458 LNITTSGDLIISDLDRQQD------QGLYTCVASSRAGKSTWSGFLRIELPT-NPN-IKFYRA-- 512
            :........|:...::.:|      :.:...|.|.......|      :.|| ||| :..||.  
  Fly  1302 ICSLQYARTIVGCFEKNRDRLPGPPENIVVSVVSDSEVNVRW------DAPTKNPNAVDGYRIFY 1360

  Fly   513 PEQTKCP----SAPGQPKILNATASALTIVWPTSDKAGASSFLGYSVEMYCTNQSRTWIPIAS-R 572
            .|....|    |:.|.|    ::.|..::..|..|...|   :..:..|..:|.:...:.|.. .
  Fly  1361 HEAAILPPTSSSSSGSP----SSDSGSSMENPGMDTLAA---MNNATSMGNSNNAMAALEIRRID 1418

  Fly   573 LSEPIFTVESLTQGAAYMFIVRAENSLGFSPPSPISEPI--TAGK---LVGVRDGSESTGT-SQL 631
            :.:...::..|.:...|..:|:|.||.|   .|.:::||  |.|:   .......|.:.|| |.:
  Fly  1419 VKDTTISINGLKKDVLYELVVKAGNSYG---ASVLTDPIRFTLGEHHVTSATSSYSSAVGTISGI 1480

  Fly   632 LLSDVETLLQANDVVELLEANASDSTTARLSWDIDSGQYIEGFYLYARELHSSEYKMVTLLNKGQ 696
            :.|.:..||.|..:|......:|...:|..:...::..|..|  |...:|.:....:.|......
  Fly  1481 VASILAILLAAAAIVFYRRQRSSYGKSANGNVAFENPTYTRG--LEQVQLPTVTSAITTQNGNHH 1543

  Fly   697 GLSSCTVPGLAKASTY 712
            |:||....|.:.:.::
  Fly  1544 GMSSSNNNGSSNSHSH 1559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo3NP_608592.2 Ig 23..117 CDD:472250
Ig strand B 40..44 CDD:409353
Ig strand C 53..57 CDD:409353
Ig strand E 77..81 CDD:409353
Ig strand F 95..100 CDD:409353
Ig strand G 109..112 CDD:409353
Ig 124..211 CDD:472250 6/21 (29%)
Ig strand B 138..142 CDD:409353
Ig strand C 152..156 CDD:409353
Ig strand E 176..180 CDD:409353
Ig strand F 190..195 CDD:409353
Ig strand G 204..207 CDD:409353 1/2 (50%)
Ig 218..302 CDD:472250 27/90 (30%)
Ig strand B 232..236 CDD:409353 1/3 (33%)
Ig strand C 245..249 CDD:409353 1/4 (25%)
Ig strand E 268..272 CDD:409353 1/3 (33%)
Ig strand F 282..287 CDD:409353 2/4 (50%)
Ig strand G 295..298 CDD:409353 1/2 (50%)
Ig 307..403 CDD:472250 26/100 (26%)
Ig strand B 323..327 CDD:409353 0/3 (0%)
Ig strand C 336..340 CDD:409353 3/3 (100%)
Ig strand E 366..372 CDD:409353 2/6 (33%)
Ig strand F 382..388 CDD:409353 2/7 (29%)
Ig strand G 396..399 CDD:409353 1/2 (50%)
Ig 413..497 CDD:472250 15/100 (15%)
Ig strand B 429..433 CDD:409353 0/3 (0%)
Ig strand C 442..446 CDD:409353 0/3 (0%)
Ig strand E 464..468 CDD:409353 0/3 (0%)
Ig strand F 479..484 CDD:409353 0/4 (0%)
Ig strand G 492..495 CDD:409353 1/2 (50%)
FN3 519..612 CDD:238020 21/99 (21%)
FN3 644..735 CDD:238020 12/69 (17%)
fn3 743..832 CDD:394996
CG17839NP_996085.2 Ig 33..116 CDD:472250
DB 185..278 CDD:460293
FN3 286..396 CDD:238020
DB 424..515 CDD:460293
FN3 524..613 CDD:238020
DB 631..>705 CDD:460293
FN3 773..>1036 CDD:442628 8/27 (30%)
FN3 934..1024 CDD:238020 5/15 (33%)
Ig 1029..1103 CDD:472250 27/87 (31%)
Ig strand B 1049..1053 CDD:409562 1/3 (33%)
Ig strand C 1062..1066 CDD:409562 0/3 (0%)
Ig strand E 1080..1083 CDD:409562 1/4 (25%)
Ig strand F 1093..1098 CDD:409562 2/4 (50%)
IG_like 1126..1216 CDD:214653 23/92 (25%)
Ig strand B 1134..1138 CDD:409390 0/3 (0%)
Ig strand C 1148..1152 CDD:409390 3/3 (100%)
Ig strand E 1182..1186 CDD:409390 0/3 (0%)
Ig strand F 1196..1201 CDD:409390 1/4 (25%)
Ig strand G 1209..1212 CDD:409390 1/2 (50%)
DB 1229..1315 CDD:460293 15/98 (15%)
FN3 1323..1457 CDD:238020 32/149 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.