DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment robo3 and Fas2

DIOPT Version :10

Sequence 1:NP_608592.2 Gene:robo3 / 33314 FlyBaseID:FBgn0041097 Length:1342 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:838 Identity:201/838 - (23%)
Similarity:305/838 - (36%) Gaps:226/838 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VFIVFLL------KWTHAQGSHPPRIVEHPIDTTVPRHE--------PATLNCK---AEGSPTPT 53
            ||:..||      :.|.||.         ||....|:.|        |..|.|:   .|.|....
  Fly    11 VFLALLLCSCSLIELTRAQS---------PILEIYPKQEVQRKPVGKPLILTCRPTVPEPSLVAD 66

  Fly    54 IQWYKDGVPLKIL--------PGSHRITLPAGGLFFLKVVNSRRETDAGIYWCEAKNELGVARSR 110
            :|| ||.....||        |..:..|||...|..:  :.|......|.|:|.|.........:
  Fly    67 LQW-KDNRNNTILPKPNGRNQPPMYTETLPGESLALM--ITSLSVEMGGKYYCTASYANTEILEK 128

  Fly   111 NATLQ--VAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIV 173
            ..|::  ||:   .:...|:|.....|...::.|.. :..|.||:.|.:.|..:.....|.|  |
  Fly   129 GVTIKTYVAI---TWTNAPENQYPTLGQDYVVMCEV-KADPNPTIDWLRNGDPIRTTNDKYV--V 187

  Fly   174 DGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKVHV--KPYIIRGPHDQTVLEGASVTFPC 236
            ....|.|::.:::|||.|.|.|. .:...|....|::|.|  :|.||..|.:...:||......|
  Fly   188 QTNGLLIRNVQESDEGIYTCRAA-VIETGELLERTIRVEVFIQPEIISLPTNLEAVEGKPFAANC 251

  Fly   237 RVGGDPMPDVLWLRTASGGNM-PLDRVSVLEDRSLRLERVTIA-----DEGEYSCEADNVVGAIT 295
            ...|.|:|::.|:|.|:..|: ..||..|.....|    |||:     |.|.|:|.|.|..|.:.
  Fly   252 TARGKPVPEISWIRDATQLNVATADRFQVNPQTGL----VTISSVSQDDYGTYTCLAKNRAGVVD 312

  Fly   296 AMGTLTVYAPPKFIQRPASKSVEL----GADT---SFECRAIGNPKPTIF---WTIKNNST---- 346
            ....|.|...|:.        .||    ||.|   :..|||.|.|.|.|.   |..:...|    
  Fly   313 QKTKLNVLVRPQI--------YELYNVTGARTKEIAITCRAKGRPAPAITFRRWGTQEEYTNGQQ 369

  Fly   347 ------LIFPGAPPLDRFHSLNTEEGHS--ILTLTRFQRTDKDLVILCNAMNEVAS------ITS 397
                  ::.|         :.:.|.|.|  .|.::..:|:| |.:..|.|.|:.|.      || 
  Fly   370 DDDPRIILEP---------NFDEERGESTGTLRISNAERSD-DGLYQCIARNKGADAYKTGHIT- 423

  Fly   398 RVQLSLDSQEDRPPPIIISGPVNQTLPIKSLATLQCKAIGLPSPTISWYRDGIPVQP--SSKLNI 460
             |:.:.|....:..|.:.|....:       |.|.|.|:|:|:.||.|:.:|..::.  .:.|.|
  Fly   424 -VEFAPDFSHMKELPPVFSWEQRK-------ANLSCLAMGIPNATIEWHWNGRKIKDLYDTNLKI 480

  Fly   461 TTSG---DLIISDLDRQQDQGLYTCVASSRAGKSTWSGFLRIELPTNPNIKFYRAPEQTKCPSAP 522
            ..:|   |||:..:.||...| |.|:|::..|.:          ..:..:|..|.|:        
  Fly   481 VGTGPRSDLIVHPVTRQYYSG-YKCIATNIHGTA----------EHDMQLKEARVPD-------- 526

  Fly   523 GQPKILNATASALTIVWPTSDKAGASSFLG-----YSVEM-------YCTNQSRTWIPIASRLSE 575
               .:..|..|.||....|.|..|.|:.||     |||:.       :.|..:|:|.|      :
  Fly   527 ---FVSEAKPSQLTATTMTFDIRGPSTELGLPILAYSVQYKEALNPDWSTAYNRSWSP------D 582

  Fly   576 PIFTVESLTQGAAYMFIVRAENSLGF-----------------SPPSPISEPITAGKLVGV---- 619
            ..:.||.|.....|.|...|.|.:|.                 ..|.|:..|:...|...|    
  Fly   583 SPYIVEGLRPQTEYSFRFAARNQVGLGNWGVNQQQSTPRRSAPEEPKPLHNPVQHDKEEPVVVSP 647

  Fly   620 ------------RDGSESTGTSQL------LLSDVETLLQAN-DVVELLEANASDSTTARLSWDI 665
                        .|..|.....|:      .:|...|.|:.: :.||::|..:.:.|        
  Fly   648 YSDHFELRWGVPADNGEPIDRYQIKYCPGVKISGTWTELENSCNTVEVMETTSFEMT-------- 704

  Fly   666 DSGQYIEGFYLYAREL-------HSSEYKMVTLLNKG---------QGLSSCTVPGLA 707
               |.:...| |..||       :||...::....:|         |..||..:.|:|
  Fly   705 ---QLVGNTY-YRIELKAHNAIGYSSPASIIMKTTRGIDVIQVAERQVFSSAAIVGIA 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
robo3NP_608592.2 Ig 23..117 CDD:472250 26/114 (23%)
Ig strand B 40..44 CDD:409353 1/3 (33%)
Ig strand C 53..57 CDD:409353 1/3 (33%)
Ig strand E 77..81 CDD:409353 1/3 (33%)
Ig strand F 95..100 CDD:409353 2/4 (50%)
Ig strand G 109..112 CDD:409353 0/2 (0%)
Ig 124..211 CDD:472250 22/86 (26%)
Ig strand B 138..142 CDD:409353 0/3 (0%)
Ig strand C 152..156 CDD:409353 1/3 (33%)
Ig strand E 176..180 CDD:409353 1/3 (33%)
Ig strand F 190..195 CDD:409353 2/4 (50%)
Ig strand G 204..207 CDD:409353 0/2 (0%)
Ig 218..302 CDD:472250 27/89 (30%)
Ig strand B 232..236 CDD:409353 0/3 (0%)
Ig strand C 245..249 CDD:409353 0/3 (0%)
Ig strand E 268..272 CDD:409353 1/3 (33%)
Ig strand F 282..287 CDD:409353 2/4 (50%)
Ig strand G 295..298 CDD:409353 0/2 (0%)
Ig 307..403 CDD:472250 29/123 (24%)
Ig strand B 323..327 CDD:409353 1/6 (17%)
Ig strand C 336..340 CDD:409353 1/6 (17%)
Ig strand E 366..372 CDD:409353 3/7 (43%)
Ig strand F 382..388 CDD:409353 1/5 (20%)
Ig strand G 396..399 CDD:409353 1/2 (50%)
Ig 413..497 CDD:472250 24/88 (27%)
Ig strand B 429..433 CDD:409353 2/3 (67%)
Ig strand C 442..446 CDD:409353 2/3 (67%)
Ig strand E 464..468 CDD:409353 3/6 (50%)
Ig strand F 479..484 CDD:409353 2/4 (50%)
Ig strand G 492..495 CDD:409353 0/2 (0%)
FN3 519..612 CDD:238020 28/121 (23%)
FN3 644..735 CDD:238020 17/80 (21%)
fn3 743..832 CDD:394996
Fas2NP_001284854.1 Ig 33..121 CDD:472250 23/90 (26%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 66..70 CDD:409353 2/4 (50%)
Ig strand E 99..103 CDD:409353 1/5 (20%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 19/72 (26%)
Ig strand B 156..159 CDD:409353 0/2 (0%)
Ig strand C 168..172 CDD:409353 1/3 (33%)
Ig strand E 190..194 CDD:409353 1/3 (33%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 29/93 (31%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 0/2 (0%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 1/2 (50%)
Ig strand D 277..281 CDD:409568 1/3 (33%)
Ig strand E 285..290 CDD:409568 3/8 (38%)
Ig strand F 298..306 CDD:409568 4/7 (57%)
Ig strand G 309..319 CDD:409568 2/9 (22%)
IG_like 330..424 CDD:214653 26/105 (25%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 2/5 (40%)
Ig strand F 404..409 CDD:409353 1/4 (25%)
Ig 447..515 CDD:409353 23/78 (29%)
Ig strand B 447..451 CDD:409353 2/3 (67%)
Ig strand C 460..464 CDD:409353 2/3 (67%)
Ig strand E 487..491 CDD:409353 2/3 (67%)
Ig strand F 501..506 CDD:409353 3/5 (60%)
FN3 525..619 CDD:238020 26/110 (24%)
FN3 640..735 CDD:238020 18/106 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.