DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5397 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001259865.1 Gene:CG5397 / 33313 FlyBaseID:FBgn0031327 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:213 Identity:45/213 - (21%)
Similarity:86/213 - (40%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 YTP--QMPDETTGLPVFVWIHPGGYRYGSAAQYD--ATPMAQR-GAIVVAPQYRLGSLGIMGDGT 194
            |:|  ::.||:. :||.|:::.|.:..|..:.|.  |..||:. .|.|:.|.|.:..        
Zfish   106 YSPRLELSDESP-VPVVVFVYGGAWGSGDRSIYCLLALQMAKELNASVICPDYSIYP-------- 161

  Fly   195 KQFDGNL--AMFDLAAALRWVTDYISYFGGNPKQVQAIGHGSGA-------------ASAMYLSM 244
               .||:  .:.|::.:|.||......|..:...:..|||.:||             ...:::..
Zfish   162 ---KGNVLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAGAHLCALTSLFLASNVEELFIET 223

  Fly   245 SPTSRSAGDVHGVVAMSGTALSQYAMDKEPVQSVQEVAKINGCPTGNELEIVNCLRSKSAEDIIK 309
            :........:.|::.:||........:.|.|::|:.|:.::....|     |......|...::|
Zfish   224 NKQKDLVTAIKGIIGLSGVYSIMDHYNHEKVRAVEYVSTMHKAMDG-----VENFDYYSPTSLLK 283

  Fly   310 NDDKVQTERLAGRALVKG 327
            ...:.|.:|:...||..|
Zfish   284 KMKEDQLKRVPPMALFHG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5397NP_001259865.1 COesterase 62..600 CDD:278561 45/213 (21%)
Aes 82..>261 CDD:223730 30/145 (21%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 45/213 (21%)
Abhydrolase 121..>210 CDD:304388 23/99 (23%)
Abhydrolase 167..336 CDD:304388 26/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.