DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5397 and Nrt

DIOPT Version :9

Sequence 1:NP_001259865.1 Gene:CG5397 / 33313 FlyBaseID:FBgn0031327 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001189121.1 Gene:Nrt / 39873 FlyBaseID:FBgn0004108 Length:846 Species:Drosophila melanogaster


Alignment Length:530 Identity:128/530 - (24%)
Similarity:188/530 - (35%) Gaps:152/530 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 VEGFRNPSTGIYSFLGMHYAEPPVGPLRYSRPVYKRLAGDFNATKHGPPC----IQPHPQ---FP 120
            |||.:  ..|.::|.|:.||:|||..||: :|.  .|..|.|.      |    :|.|..   ..
  Fly   370 VEGVK--EDGAFAFRGIPYAKPPVDRLRW-KPA--ELIDDINM------CWNDTLQTHNSSVVCT 423

  Fly   121 QRI-----IGDEDCLLLNVYTPQMPDETTGLPVFVWI--------HPGGYRYGSAAQYDATPMAQ 172
            ||:     :||||||.|:|.||.: .....|||.|.|        .||..|  .:|:|..:    
  Fly   424 QRLGNGTTVGDEDCLYLDVVTPHV-RYNNPLPVVVLIGAESLAGPSPGILR--PSARYSRS---- 481

  Fly   173 RGAIVVAPQYRLGSLGIMG-DG-TKQ----FDGNLAMFDLAAALRWVTDYISYFGGNPKQVQAIG 231
            ...|.|.|.:|||..|.:. |. ||:    ..||.|:.|:.|.|.|:...|.:|||:|:.|..:|
  Fly   482 HDVIFVRPNFRLGVFGFLALDALTKEAHPPTSGNYALTDIIAVLNWIKLNIVHFGGDPQSVTLLG 546

  Fly   232 HGSGAASAMYLSMSPTSRS----AGDVHGVVAMSGTALSQYAMDKEPVQSVQEVAKINGCPTGNE 292
            |.:||.....|..|...:.    |....|...:.|..||:.....|.:.:..|.|.|        
  Fly   547 HRAGATLVTLLVNSQKVKGLYTRAWASSGSAILPGKPLSESGKQNEQLMATLECADI-------- 603

  Fly   293 LEIVNCLRSKSAEDI--------------IKNDDKVQTERLAGRALVKGLTGNVGFQPHIESEDD 343
                .|||..|:|.:              :....:..........||  |.|:|.|:        
  Fly   604 ----QCLREASSERLWAATPDTWLHFPVDLPQPQEANASGSRHEWLV--LDGDVVFE-------- 654

  Fly   344 GRALPSLIVGEPEQQLKSSNFSGIPLLT-GVTKHET---------------------------AN 380
                      .|....|....:..|:|. |.|.||.                           |.
  Fly   655 ----------HPSDTWKREQANDKPVLVMGATAHEAHTEKLRELHANWTREEVRAYLENSQIGAL 709

  Fly   381 SVTVETIEKVFGSAEQFLGSLSDSLNKLTSFLKIDKLTGQIAKPELPGLTSVLTPTLQDVWKVPQ 445
            .:|.|.|||...|:...|.|:...:..:...     ||....:|.:|            .:.|.|
  Fly   710 GLTDEVIEKYNASSYASLVSIISDIRSVCPL-----LTNARQQPSVP------------FYVVTQ 757

  Fly   446 ALNVDQVLSKVVESTTDVLFNLPAVL-----TTQVWSRLAPAFMYSFEYNGTKSKGINFLKGLPI 505
            ....||:      :|.|.  ::.|:|     .|....|...|....|.|..:.....:|::...:
  Fly   758 GEGPDQL------ATVDA--DVQAILGRYEPHTVEQRRFVSAMQQLFYYYVSHGTVQSFVQNRRV 814

  Fly   506 VSETAHDKPE 515
            ::.....:||
  Fly   815 INVGQDAQPE 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5397NP_001259865.1 COesterase 62..600 CDD:278561 128/530 (24%)
Aes 82..>261 CDD:223730 66/208 (32%)
NrtNP_001189121.1 Abhydrolase 362..832 CDD:304388 128/530 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11559
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.