DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5397 and Gli

DIOPT Version :10

Sequence 1:NP_608591.1 Gene:CG5397 / 33313 FlyBaseID:FBgn0031327 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_476602.1 Gene:Gli / 34927 FlyBaseID:FBgn0001987 Length:956 Species:Drosophila melanogaster


Alignment Length:100 Identity:27/100 - (27%)
Similarity:35/100 - (35%) Gaps:24/100 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 DFLEFLKTVNIKFGSGAFVDAVVGYELLSKA----TWEEMDRANF--SEIVPLFIDV-------- 99
            :|||..|:: .|.... .|.|:.|.:|.|||    |.:.:|..|.  |....||.|.        
  Fly   321 NFLESYKSL-YKLAKD-IVGALKGRDLNSKAYNAETEKLLDELNLCKSGFNSLFEDTWHTLMGFE 383

  Fly   100 --------AGNLALKYGSVEEANRFARALPGQVYL 126
                    .||...:....|..|.|.....||..|
  Fly   384 MQLFERTEEGNSTFENTIKEMTNEFIEMAQGQFVL 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5397NP_608591.1 COesterase 48..599 CDD:395084 26/99 (26%)
GliNP_476602.1 COesterase 137..695 CDD:395084 26/99 (26%)
PRK13335 818..>918 CDD:139494
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.