DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5397 and Nlg2

DIOPT Version :9

Sequence 1:NP_001259865.1 Gene:CG5397 / 33313 FlyBaseID:FBgn0031327 Length:665 Species:Drosophila melanogaster
Sequence 2:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster


Alignment Length:448 Identity:126/448 - (28%)
Similarity:193/448 - (43%) Gaps:116/448 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLLLSVVI---LASCKSGGDAHVRVK-RIVGGKQSKAPPVDDPVIFARLFDRDARVEGFRNPS 70
            ||:|||...:   ...|..||...|:.| .::.|...::.|:                       
  Fly   161 LLVLLLLTSLWPDCCECLHGGSNTVKTKYGLLRGIVVRSSPL----------------------- 202

  Fly    71 TGIYSFLGMHYAEPPVGPLRYSRPV----YKRLAGDFNATKHGPPCIQ----PHPQFPQRII--- 124
              :.:|||:.||.||||.||:..|:    :|.:.   :|.:..|.|.|    | |..|:.::   
  Fly   203 --VEAFLGIPYASPPVGSLRFMPPITPSTWKTVR---SADRFSPVCPQNIPIP-PNGPEALLEVP 261

  Fly   125 ----------------GDEDCLLLNVYTP-------QMPDETTGLP-----VFVWIHPGGYRYGS 161
                            ..||||.||:|.|       :..|:|||.|     ..|:||...|.:.|
  Fly   262 RARLAQLRRLLPLLKNQSEDCLYLNIYVPYETRRQRRNTDDTTGEPKTKLSTVVFIHGESYDWNS 326

  Fly   162 AAQYDATPMAQRG-AIVVAPQYRLGSLGIMGDGTKQ-FDGNLAMFDLAAALRWVTDYISYFGGNP 224
            ...||.:.:|..| .|||...:|||..|.:..|.|: ..||..:.||.|.|.|:.:.:..|||:|
  Fly   327 GNPYDGSELAAHGNVIVVTINFRLGIFGFLKTGGKESAQGNFGLMDLVAGLHWLKENLPAFGGDP 391

  Fly   225 KQVQAIGHGSGAASAMYLSMSPTSRSAGD-VHGVVAMSGTALSQYAMDKEPVQSVQEVAKINGCP 288
            :.:..:|:|:||..|..|.:||.   |.| :...|.:||:|||.:|:.|.|:...:.||:..|| 
  Fly   392 QSITLLGYGTGAVLANILVVSPV---ASDLIQRTVLVSGSALSPWAIQKNPLFVKRRVAEQTGC- 452

  Fly   289 TGNEL--EIVNCLRSKSAEDIIKNDDKVQTERLAGRALVKGLTGNVGFQPHIESEDDGRA----- 346
            .|:.|  ::..|||:||..:::.  .||...|..           |||.|.:    ||..     
  Fly   453 HGDMLYDDLAPCLRTKSVAELLA--VKVDHPRFL-----------VGFAPFV----DGTVISPGA 500

  Fly   347 ---------LPSLIVGEPEQQLKSSNFSGIPLLTGVTKHETANSVTVETIEKVFGSAE 395
                     |.|.||.  ...::.:||....|:..:|..|:...::.:.:|  ||..|
  Fly   501 NPLGSTTLPLGSAIVS--TSGIEYANFPKRDLIFCLTSVESYLDLSAQDLE--FGFNE 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5397NP_001259865.1 COesterase 62..600 CDD:278561 114/392 (29%)
Aes 82..>261 CDD:223730 69/220 (31%)
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 118/427 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.