DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42329 and oac-56

DIOPT Version :9

Sequence 1:NP_608590.2 Gene:CG42329 / 33312 FlyBaseID:FBgn0259229 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_502742.1 Gene:oac-56 / 190505 WormBaseID:WBGene00013450 Length:644 Species:Caenorhabditis elegans


Alignment Length:434 Identity:93/434 - (21%)
Similarity:156/434 - (35%) Gaps:131/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 IPCLNGIRCLTIIWIILGHGYMYLLLAPTINAYDIVAWAQMPFSMILQSGTTSVDTFFLLSGLLL 317
            |.||.||   .||:::|.|      |.|.                :..:|...||.||::||.|:
 Worm     5 IQCLRGI---AIIFVLLFH------LNPN----------------LFVNGFLGVDIFFVISGFLM 44

  Fly   318 VLSALREMDRSK-GRLH-VPLMYLHRLVRLTPVLALAVLIFMTLFPRLDSGPLWNQFTSSSELC- 379
            .    :.:.::| .::| ..|.|..|..|:.|:..|||.:.:.:                ::|| 
 Worm    45 A----KNLTKAKLVKIHDFLLFYYMRFRRILPMYFLAVFLIVVM----------------TQLCL 89

  Fly   380 SDTWW--------ATLLYVQN--------------YAAPGRM-CLGHSWYLAVDMQLYIISPLLL 421
            .|..|        |:|..|.|              :||...: ...|.|.|:::||.|:..|::.
 Worm    90 GDFLWKNNNRYALASLFMVTNQLIIHDQADYFNEFFAATSSINGFLHLWSLSLEMQFYLFVPIIF 154

  Fly   422 IALYKWGKKAIAGIVLLILLLSGCVFGIVMLRDLKVFDRYGNLGGDSTEMRLIYYTTHARATPWL 486
            ..|.......:....:||:.:.|.: |..::.|...|        :...:||..::....|..| 
 Worm   155 FGLQFLKNDYLKLATVLIISVFGFI-GFALILDKFAF--------NFMFLRLWQFSVGFSALFW- 209

  Fly   487 IGLLFGYFLHHQNVRKTRLPKWLALVLWILSLSMLATVIFAVYPYTQSGAGDISAMAGAFYLCCS 551
                 .....:....||..|......   |:.:.|.||             .:||:|    ||.|
 Worm   210 -----SKIQENGTPSKTEKPSTFTCP---LTKNDLVTV-------------SLSALA----LCLS 249

  Fly   552 R------IAWPL--ALCWIIWACQNGLAPIVN-EFLSWSFWQPLSKLSYCLYIWHLLVETVHIAR 607
            .      :..||  ....:|.||::     .| :||.......:..:||.||:.|..|.::.:..
 Worm   250 TMEIKVLVLRPLVTVATAVIIACES-----KNFQFLKSPTLGYIGDISYVLYLVHWPVISIFLIS 309

  Fly   608 IKTSLHFSDYDAILRFWSDFGITLFVSMFMHLCVEVPLGRLEME 651
            ...|..|    .|:       |....|:.:|...|....:|:|:
 Worm   310 NARSYIF----CIM-------IIFISSILLHHLFEKQYLKLDMK 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42329NP_608590.2 NRF 71..179 CDD:214781
OafA 253..648 CDD:224748 91/429 (21%)
Acyl_transf_3 253..639 CDD:280013 89/420 (21%)
oac-56NP_502742.1 OafA 1..339 CDD:224748 91/429 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.