DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42329 and oac-24

DIOPT Version :9

Sequence 1:NP_608590.2 Gene:CG42329 / 33312 FlyBaseID:FBgn0259229 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_504267.3 Gene:oac-24 / 185503 WormBaseID:WBGene00018211 Length:650 Species:Caenorhabditis elegans


Alignment Length:428 Identity:95/428 - (22%)
Similarity:147/428 - (34%) Gaps:150/428 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 IPCLNGIRCLTIIWIILGHGYMYLLLAPTINAYDIVAWAQMPFSMILQSGTTSVDTFFLLSGLLL 317
            |.||.||   .|:.:.:.|      |.||                :..:|...||.||::||.|:
 Worm     5 IQCLRGI---AIVCVFIYH------LFPT----------------LFVNGFLGVDVFFVISGYLM 44

  Fly   318 VLSALREMDRSKGRLHVPLMYLHRLVRLTPVLALAVLIFMTLFPRLDSGPLW--NQFTSSSELCS 380
            ..: |.:...||....:. .|..|..|:.||..|.:|:.:.|........||  |.....:.||.
 Worm    45 AKN-LTKTKLSKVSDFIS-FYYRRFKRILPVYYLVILVTVILLRIYYEDFLWGNNDRYGLASLCL 107

  Fly   381 DTWWATLL------YVQNYAAPGRMCLG---HSWYLAVDMQLYIISPLLLIALYKWGKK------ 430
            .|  ..|:      |.:.:.|. |..|.   |.|.|:|:||.|::.|.:...|..:.|:      
 Worm   108 VT--NQLIIHDQADYFREFQAE-RSSLNIFVHLWSLSVEMQFYLLVPFIFFGLQHYKKETCKLMT 169

  Fly   431 ----AIAGIVLLILLLSGCVFGIVMLRDLKVFDRYGNLGGDSTEMRLIYYTTHARATPWLIGLLF 491
                :|.|.|...|:.|...|..:.||          |...|.....:::|   ::.|..:..: 
 Worm   170 VSIISIFGFVGFALVNSAFAFNFMFLR----------LWQFSAGFIALFWT---KSFPSQVAKI- 220

  Fly   492 GYFLHHQNVRKTRLPKW--------LALVLWILSLSMLAT----------------VIFAV---- 528
            .....:.:|.:.:..|:        :.|.|.::||..|.|                .|.||    
 Worm   221 SEKSENSDVSENKFQKFCSVSKEDSVMLALTVISLCALPTKIDVLISRPMVTAATAFIIAVESKD 285

  Fly   529 ----YPYTQSGAGDISAMAGAFYLCCSRIAWPL------------ALCWII-------------- 563
                ...|.|..||||.:   .||    :.||:            ..|.:|              
 Worm   286 NQILESRTLSYIGDISYV---MYL----VHWPIISIFIESTLKSHLFCIMITLVASIILHHLFEK 343

  Fly   564 ------WACQNGLAPIV------NEFLSWS-----FWQ 584
                  |   .|:.|:|      |.:|.:|     |||
 Worm   344 QYLQMNW---KGVVPLVLVLILGNAYLQYSIRNDKFWQ 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42329NP_608590.2 NRF 71..179 CDD:214781
OafA 253..648 CDD:224748 95/428 (22%)
Acyl_transf_3 253..639 CDD:280013 95/428 (22%)
oac-24NP_504267.3 OafA 1..343 CDD:224748 85/388 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.