DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJA3

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_005138.3 Gene:DNAJA3 / 9093 HGNCID:11808 Length:480 Species:Homo sapiens


Alignment Length:395 Identity:105/395 - (26%)
Similarity:161/395 - (40%) Gaps:113/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNK-AANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            :|||:|||:|:.|:..||||||.:||.:||||.|| ...|::||.::|||||||||:.||:.||.
Human    92 EDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDA 156

  Fly    67 YGEDGLKSGGTRN------GGPSSNSFTYQFHGDPRATFAQFFG--NSNPFASF---FDMGDNLF 120
            ||..|...|.:.:      |||:.         ||...|.:.||  :|:.|..|   ||.....|
Human   157 YGSAGFDPGASGSQHSYWKGGPTV---------DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYF 212

  Fly   121 DKKVFDLDTEPDFFSSPFGGIGSRHGL----------GSGFRPSFRSHSFNVHTPFKKEQKQDPP 175
            .:..|:...:         |:.....:          |.|..|..:                   
Human   213 MELTFNQAAK---------GVNKEFTVNIMDTCERCNGKGNEPGTK------------------- 249

  Fly   176 VEHDLYV---TLEEIYHGCVKKMKISRR------------IVQADGSSRKEEKFLAISIKPGWKS 225
            |:|..|.   .:|.|..|........||            :|.......|::|.:.|.:..|.:.
Human   250 VQHCHYCGGSGMETINTGPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVED 314

  Fly   226 GTKVTFQKEGDQAP-GKIPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCG---------- 279
            |..|       :.| ||....|.|.::..|  :|:|:|:|:.....:::.|||.|          
Human   315 GQTV-------RMPVGKREIFITFRVQKSP--VFRRDGADIHSDLFISIAQALLGGTARAQGLYE 370

  Fly   280 ---VVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAA 341
               |.....|.:..|:|:.       ...:.||..||.         ||..:...|:.|::||:.
Human   371 TINVTIPPGTQTDQKIRMG-------GKGIPRINSYGY---------GDHYIHIKIRVPKRLTSR 419

  Fly   342 QKEVL 346
            |:.::
Human   420 QQSLI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 105/395 (27%)
DnaJ 4..65 CDD:278647 36/61 (59%)
DnaJ_C 174..338 CDD:199909 41/192 (21%)
DNAJA3NP_005138.3 DnaJ 90..480 CDD:223560 105/395 (27%)
DnaJ 93..155 CDD:278647 36/61 (59%)
DnaJ_C 207..416 CDD:199909 47/261 (18%)
DnaJ_zf 236..296 CDD:199908 12/78 (15%)
CXXCXGXG motif 236..243 1/6 (17%)
CXXCXGXG motif 253..260 1/6 (17%)
CXXCXGXG motif 275..282 2/6 (33%)
CXXCXGXG motif 289..296 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.