DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and APJ1

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_014322.1 Gene:APJ1 / 855647 SGDID:S000005021 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:437 Identity:105/437 - (24%)
Similarity:173/437 - (39%) Gaps:110/437 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLPKTATDDEIKKAYRKLALRYHPDKNK-AANAEDKFKEVAEAYEVLSDKSKREVYDKYG- 68
            |..|.:...|:..|||||||..||:||||||. ...::.||:|:.:|||:|.|...|.:||:|| 
Yeast     8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKDNRLRALYDQYGT 72

  Fly    69 ------EDGLKSGGTRNGGPSSNSFTYQFHG------DPRATFAQFFG-----NSNPFASFFDMG 116
                  ::.......:..||.|:|..:....      .|...|||||.     :||...|.|:..
Yeast    73 TDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFNSSATPSSNGSKSSFNFS 137

  Fly   117 DNLFDKKVFDLDTEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLY 181
                    |:..:.|.|......|:.:.:...:.:..:...|..:          :.|.::|:|.
Yeast   138 --------FNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLD----------RGPDIKHNLK 184

  Fly   182 VTLEEIYHGCVKKMKISR-RIVQ-ADGSSR----------------------------------- 209
            .||:|:|.|...|:.::| ||.. .||...                                   
Yeast   185 CTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKCTCKTCKGQGIQTQTRRMGPLVQSWSQTCADC 249

  Fly   210 ----------------------KEEKFLAISIKPGWKSGTKVTFQKEGDQAPGK--------IPA 244
                                  ||.|.|.::::||......:....|||:....        ||.
Yeast   250 GGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEVISTKGGGHEKVIPG 314

  Fly   245 DIVF-IIRDK-PHAMFKREGSDLRYTARLTLKQALC-GVVFQVPTMSGDKLRISTMQ-EIIKPNT 305
            |:|. |:|.| |:.......:.:....::....:|| |||:.....||..:::..:. ||:||..
Yeast   315 DVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHPSGKLIKLDIIPGEILKPGC 379

  Fly   306 VKRIQGYGLPFPKDTTRK--GDLLVAFDIQFPEKLTAAQKEVLKDML 350
            .|.::..|:|...:..|.  |.|.|.||:.:||:|.....:.::::|
Yeast   380 FKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPERLEPENAKKIQNIL 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 104/432 (24%)
DnaJ 4..65 CDD:278647 27/59 (46%)
DnaJ_C 174..338 CDD:199909 53/236 (22%)
APJ1NP_014322.1 DnaJ 2..427 CDD:223560 105/437 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.