DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and JJJ3

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_012631.3 Gene:JJJ3 / 853560 SGDID:S000003858 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:139 Identity:43/139 - (30%)
Similarity:67/139 - (48%) Gaps:25/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDK-NKAAN---AEDKFKEVAEAYEVLSDKSKREVYD 65
            :|:||.:|..||.||||||||...|..|||| :|:.:   :.....::.:||::||:...|..||
Yeast     9 HYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIKTRREYD 73

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFT---YQFHGD--------PRATFAQFFGNSNPFASFFDMGDNL 119
            :...:..|..|..|.|...:.|:   :.|..|        ||   .||.|.       |...::|
Yeast    74 RLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPR---CQFVGG-------FHFSESL 128

  Fly   120 FDKKVFDLD 128
            .|:.:.::|
Yeast   129 LDECIDNVD 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 43/139 (31%)
DnaJ 4..65 CDD:278647 25/63 (40%)
DnaJ_C 174..338 CDD:199909
JJJ3NP_012631.3 DnaJ 8..73 CDD:395170 25/63 (40%)
zf-CSL 93..164 CDD:398744 12/55 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.