DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and JJJ2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:236 Identity:59/236 - (25%)
Similarity:99/236 - (41%) Gaps:55/236 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69
            ||.||||...||..|:.|:|.|||...||||.|:..:|:.||.|..|:.:|:|:.::..||:   
Yeast    14 YYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHAHSILTDEDQKLRYDR--- 75

  Fly    70 DGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFF 134
             .||..|.....|..|...::       |.|:....::|         .|...:.:....:| :.
Yeast    76 -DLKIKGLHTYQPKKNCHIFK-------TKAKESQGASP---------TLGQSEAYHRQNKP-YE 122

  Fly   135 SSPFG-GIGSRHGLGSGFR-PSFRSHSF-----NVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCV 192
            ..|:| |:|.:....|..: |.|:|.:.     |.:...|||:|...|       .::.::|   
Yeast   123 QQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSP-------DIDSLFH--- 177

  Fly   193 KKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQK 233
                      :.:|:|:       :.:....|..|...||:
Yeast   178 ----------ETNGASK-------VRMTDAGKMDTNSQFQE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 59/236 (25%)
DnaJ 4..65 CDD:278647 26/59 (44%)
DnaJ_C 174..338 CDD:199909 8/60 (13%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.