DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and AT1G44160

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_175080.2 Gene:AT1G44160 / 841019 AraportID:AT1G44160 Length:357 Species:Arabidopsis thaliana


Alignment Length:348 Identity:102/348 - (29%)
Similarity:161/348 - (46%) Gaps:30/348 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGEDGLKSGGTRN---G 80
            ::.|..|.::.....||.|   ...|.|...:..:.|.::.||...:.:.....|..|..|   |
plant    20 DLFKLCRSISRVLPRDKTK---HHHKAKHDTKETKRLDEEHKRNTPNAFEFRETKGIGKNNKVEG 81

  Fly    81 GPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFSSPFGG----I 141
            .......:|:|...          |:|...|...:..:..........|.|...|..|.|    .
plant    82 VSLCKVRSYRFDNT----------NTNFVGSKKSLSRSCSQNTATATSTNPTLRSLSFIGRSKSS 136

  Fly   142 GSRHGLGSGFRPSFRSHSFNVHTPF---------KKEQKQDPPVEHDLYVTLEEIYHGCVKKMKI 197
            .:|.....||.|:....:..|...|         ..:..:..|.|..|..||||:.:||.||:||
plant   137 SNRMTESGGFMPTLMRSTTTVPRSFANPILYSSSSAKVAKPSPTEKKLRCTLEELCNGCTKKIKI 201

  Fly   198 SRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREG 262
            .|.::.:.|...:||:.:.|.:|||||.||||||:.:|::|...:|||:.|:|.:|.|.:|||||
plant   202 KRDVITSLGEKCEEEEMVEIKVKPGWKGGTKVTFEGKGNEAMRSVPADLTFVIVEKEHEVFKREG 266

  Fly   263 SDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLL 327
            .||.....::|.:||.|....|..:.||.:|: .::::|.|..|..:||.|:|..|:..::|||.
plant   267 DDLEMAVEVSLLEALTGCELSVALLDGDNMRL-RIEDVIHPGYVTVVQGKGMPNLKEKGKRGDLR 330

  Fly   328 VAFDIQFPEKLTAAQKEVLKDML 350
            |.|..:||:.||..|:..:..:|
plant   331 VRFRTKFPQHLTDEQRAEIHSIL 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 101/343 (29%)
DnaJ 4..65 CDD:278647 10/45 (22%)
DnaJ_C 174..338 CDD:199909 68/163 (42%)
AT1G44160NP_175080.2 DnaJ_C 178..341 CDD:199909 68/163 (42%)
DnaJ <221..357 CDD:223560 55/134 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1434
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24078
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.