DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and J2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_568412.1 Gene:J2 / 832267 AraportID:AT5G22060 Length:419 Species:Arabidopsis thaliana


Alignment Length:409 Identity:125/409 - (30%)
Similarity:184/409 - (44%) Gaps:127/409 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69
            :|:|||:||||..:::||||:|.|::.||||   ....:||||:|:|||||||..|||:||:|||
plant    15 FYEILGVPKTAAPEDLKKAYKKAAIKNHPDK---GGDPEKFKELAQAYEVLSDPEKREIYDQYGE 76

  Fly    70 DGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFF 134
            |.||.|  ..||.                     |..:||                      |.|
plant    77 DALKEG--MGGGG---------------------GGHDPF----------------------DIF 96

  Fly   135 SSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISR 199
            ||.|         |||..| |.|||..      :.|::...|.|.|.|:||::|.|..||:.:||
plant    97 SSFF---------GSGGHP-FGSHSRG------RRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSR 145

  Fly   200 RIV--------QADGSSRK---------------------------------------------- 210
            :.:        ...|:|.|                                              
plant   146 KALCSKCNGKGSKSGASMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQ 210

  Fly   211 --------EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRY 267
                    |:|.|.::::.|.:...|:||..:.|:||..:..||||:|:.|.|..|||:|.||..
plant   211 CKGEKVVSEKKVLEVNVEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFV 275

  Fly   268 TARLTLKQALCGVVFQVPTMSGDKLRI-STMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFD 331
            ...::|.:||||..|.:..:...:|.| |...|::||::.|.|...|:|..:....||.|.:.|.
plant   276 EHTISLTEALCGFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFT 340

  Fly   332 IQFPEKLTAAQKEVLKDML 350
            ::|||.|:..|.:.::.:|
plant   341 VEFPESLSPDQTKAIEAVL 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 124/404 (31%)
DnaJ 4..65 CDD:278647 33/59 (56%)
DnaJ_C 174..338 CDD:199909 61/226 (27%)
J2NP_568412.1 PTZ00037 7..419 CDD:240236 125/409 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.