DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and J3

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_189997.1 Gene:J3 / 823531 AraportID:AT3G44110 Length:420 Species:Arabidopsis thaliana


Alignment Length:410 Identity:123/410 - (30%)
Similarity:185/410 - (45%) Gaps:130/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGE 69
            :|:|||:||:|:.:::||||:|.|::.||||   ....:||||:|:|||||||..|||:||:|||
plant    15 FYEILGVPKSASPEDLKKAYKKAAIKNHPDK---GGDPEKFKELAQAYEVLSDPEKREIYDQYGE 76

  Fly    70 DGLKSG-GTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDF 133
            |.||.| |...||          | ||...|:.|||                             
plant    77 DALKEGMGGGGGG----------H-DPFDIFSSFFG----------------------------- 101

  Fly   134 FSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKIS 198
             ..||||..||                      ::.|::...|.|.|.|:||::|.|.:||:.:|
plant   102 -GGPFGGNTSR----------------------QRRQRRGEDVVHPLKVSLEDVYLGTMKKLSLS 143

  Fly   199 RRIV--------QADGSSRK--------------------------------------------- 210
            |..:        ...|:|.|                                             
plant   144 RNALCSKCNGKGSKSGASLKCGGCQGSGMKVSIRQLGPGMIQQMQHACNECKGTGETINDRDRCP 208

  Fly   211 ---------EEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLR 266
                     |:|.|.::::.|.:...|:||:.:.|:||..:..||||:::.|.|..|||:|.||.
plant   209 QCKGDKVIPEKKVLEVNVEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLF 273

  Fly   267 YTARLTLKQALCGVVFQVPTMSGDKLRI-STMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAF 330
            ....|:|.:||||..|.:..:.|..|.| |...|::||::.|.|...|:|..:....||.|.:.|
plant   274 VEHTLSLTEALCGFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHF 338

  Fly   331 DIQFPEKLTAAQKEVLKDML 350
            .::||:.|:..|.:.|:.:|
plant   339 TVEFPDSLSPDQTKALEAVL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 121/405 (30%)
DnaJ 4..65 CDD:278647 32/59 (54%)
DnaJ_C 174..338 CDD:199909 61/226 (27%)
J3NP_189997.1 PTZ00037 7..420 CDD:240236 123/410 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.