DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and DNAJB14

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:266 Identity:78/266 - (29%)
Similarity:110/266 - (41%) Gaps:69/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |:||::||:.|.|.|:::|||||||||::|||||.|..|.|.||::..||.|||:..||:.||..
Human   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLT 171

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHG------DPRATFAQFFGNSNPFASFF------------- 113
            |.:........||       .:.||.      .|...|..|||...|..|..             
Human   172 GNEEQACNHQNNG-------RFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAGYSQQH 229

  Fly   114 -----------DMGDNLFDKKVFDLDTEPD------------FFSSPFGGIGSRHGLGSGFRPSF 155
                       :.||..|  .|| :...|.            ..|:|...:..|.|.|...:...
Human   230 QHRHSGHEREEERGDGGF--SVF-IQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGTGQTIKMQT 291

  Fly   156 RSHS--FNVHTPFKKE------QKQDPPVEHDLYVTLEEIYHGCVKK------MKISRRIVQADG 206
            .:..  :.|:..||.|      ||.:..||.| |||  .|.:.|.|:      |:.:.::.:.|.
Human   292 ENLGVVYYVNKDFKNEYKGMLLQKVEKSVEED-YVT--NIRNNCWKERQQKTDMQYAAKVYRDDR 353

  Fly   207 SSRKEE 212
            ..||.:
Human   354 LRRKAD 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 78/266 (29%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 174..338 CDD:199909 13/45 (29%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94
DnaJ 107..>214 CDD:223560 47/113 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241 0/21 (0%)
DUF1977 271..371 CDD:370429 24/92 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154092
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.