DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajb14

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001071255.1 Gene:dnajb14 / 792752 ZFINID:ZDB-GENE-061110-138 Length:380 Species:Danio rerio


Alignment Length:262 Identity:74/262 - (28%)
Similarity:110/262 - (41%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |:||::||:.|.|:|||:|||||:|||::|||||.|..|.|.||::..||.|||:..|:..||  
Zfish   110 KNYYEVLGIRKDASDDELKKAYRQLALKFHPDKNHAPGATDAFKKIGNAYSVLSNPEKKRQYD-- 172

  Fly    68 GEDGLKSGGTRNGGPSSNSFT-YQFHG------DPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125
                 .|||.....|:.:|.. :.||.      .|...|..|||.|.|.::..:..:.    :.:
Zfish   173 -----LSGGEEPSTPNYSSHEGFDFHRGFESDITPEDLFNMFFGGSFPSSNSHEFTNG----RTY 228

  Fly   126 DLDTEPD----------------------------------FFSSPFGGIGSRHGLGSGFRPSFR 156
            ...||..                                  ..|:|...:.||...|.    :.:
Zfish   229 SHHTEETRGERVEERGDGGFSMFIQLMPIVVLVLVSILSQLLVSTPPYSLYSRPSTGQ----TVK 289

  Fly   157 SHSFNVH------TPFKKEQKQ------DPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSR 209
            ..:.|:|      |.||.|.|.      :..||.| ||:  .:.:.|.|:.:....::.|....|
Zfish   290 RQTENLHVDYFVTTDFKSEYKGSALLKIEKSVEED-YVS--NVRNNCWKERQTKTDLLYAAKVYR 351

  Fly   210 KE 211
            .|
Zfish   352 DE 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 74/262 (28%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 174..338 CDD:199909 10/38 (26%)
dnajb14NP_001071255.1 DnaJ 110..>218 CDD:223560 50/114 (44%)
DnaJ 111..172 CDD:278647 33/60 (55%)
DUF1977 272..372 CDD:286411 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589218
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.