Sequence 1: | NP_001245832.1 | Gene: | CG5001 / 33308 | FlyBaseID: | FBgn0031322 | Length: | 350 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001071255.1 | Gene: | dnajb14 / 792752 | ZFINID: | ZDB-GENE-061110-138 | Length: | 380 | Species: | Danio rerio |
Alignment Length: | 262 | Identity: | 74/262 - (28%) |
---|---|---|---|
Similarity: | 110/262 - (41%) | Gaps: | 71/262 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
Fly 68 GEDGLKSGGTRNGGPSSNSFT-YQFHG------DPRATFAQFFGNSNPFASFFDMGDNLFDKKVF 125
Fly 126 DLDTEPD----------------------------------FFSSPFGGIGSRHGLGSGFRPSFR 156
Fly 157 SHSFNVH------TPFKKEQKQ------DPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSSR 209
Fly 210 KE 211 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5001 | NP_001245832.1 | DnaJ | 1..347 | CDD:223560 | 74/262 (28%) |
DnaJ | 4..65 | CDD:278647 | 33/60 (55%) | ||
DnaJ_C | 174..338 | CDD:199909 | 10/38 (26%) | ||
dnajb14 | NP_001071255.1 | DnaJ | 110..>218 | CDD:223560 | 50/114 (44%) |
DnaJ | 111..172 | CDD:278647 | 33/60 (55%) | ||
DUF1977 | 272..372 | CDD:286411 | 22/89 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589218 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |