DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajc18

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_083945.1 Gene:Dnajc18 / 76594 MGIID:1923844 Length:357 Species:Mus musculus


Alignment Length:123 Identity:49/123 - (39%)
Similarity:70/123 - (56%) Gaps:10/123 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ::||.|||:...|:|:|:||||:||||::|||||.|..|.:.||.:..|:.|||:..||..||:|
Mouse    81 RNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATEAFKAIGNAFAVLSNPDKRLRYDEY 145

  Fly    68 GEDGLKSGGTRNGGPSSNSFTY--QFHGD--PRATFAQFFGNSNPFASFFDMGDNLFD 121
            |::.:..     ..|.:.|:.|  .|..|  |...|..|||...|..: ..|..|:.|
Mouse   146 GDEQVTF-----TVPRARSYHYYKDFEADISPEELFNVFFGGHFPSGN-IHMFSNVTD 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 49/123 (40%)
DnaJ 4..65 CDD:278647 31/60 (52%)
DnaJ_C 174..338 CDD:199909
Dnajc18NP_083945.1 PRK14298 81..>182 CDD:184612 44/105 (42%)
DUF1977 250..349 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.