DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb14

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001028327.1 Gene:Dnajb14 / 70604 MGIID:1917854 Length:379 Species:Mus musculus


Alignment Length:367 Identity:88/367 - (23%)
Similarity:134/367 - (36%) Gaps:122/367 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |:||::||:.|.|.|:::|||||||||::|||||.|..|.|.||::..||.|||:..||:.||..
Mouse   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYDLT 171

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPD 132
            |.:........||       .:.||....|..                             |..|
Mouse   172 GSEEQACNHQNNG-------RFNFHRGCEADI-----------------------------TPED 200

  Fly   133 FFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKI 197
            .|:..|||         || ||...|||:........|.|.                        
Mouse   201 LFNIFFGG---------GF-PSGSVHSFSNGRAAYSHQHQH------------------------ 231

  Fly   198 SRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFI--------IRDKP 254
                 :..|..|:||:.         ..|..|..|        .:|..::.:        :.:.|
Mouse   232 -----RHSGHEREEERA---------DGGFSVFIQ--------LMPIIVLILVSLLSQLMVSNPP 274

  Fly   255 HAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEI-----------IKPNTVKR 308
            ::::.|.||.    ..:.::....|||:.|......:.:.:.:|::           |:.|..|.
Mouse   275 YSLYPRSGSG----QTIKMQTENLGVVYYVSKDFKSEYKGTLLQKVEKSVEEDYVTNIRNNCWKE 335

  Fly   309 IQ-----GYGLPFPKD--TTRKGDLLVAFDIQFPEKLTAAQK 343
            .|     .|.....:|  ..||.|.|...:.:..|:||:..|
Mouse   336 RQQKTDMQYAAKVYRDEQLRRKADALSMENCKELERLTSLYK 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 88/367 (24%)
DnaJ 4..65 CDD:278647 33/60 (55%)
DnaJ_C 174..338 CDD:199909 28/189 (15%)
Dnajb14NP_001028327.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..90
DnaJ 107..>214 CDD:223560 52/152 (34%)
DnaJ 108..169 CDD:278647 33/60 (55%)
DUF1977 271..371 CDD:286411 19/103 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844337
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.