DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb13

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_705755.2 Gene:Dnajb13 / 69387 MGIID:1916637 Length:316 Species:Mus musculus


Alignment Length:353 Identity:150/353 - (42%)
Similarity:215/353 - (60%) Gaps:42/353 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            ||.|||.:|.:.:.:.|.:||||||||||:.||.|:....|.:.||::||||:||||..||.:||
Mouse     1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAPEIFKQIAEAYDVLSDPVKRGIYD 65

  Fly    66 KYGEDGLKSGGTRNGGPSSNSFT--YQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLD 128
            |:||:|||.|.....| |...:|  |.|||:|...|.:|||..|||:.|||...|       |:|
Mouse    66 KFGEEGLKGGIPLEFG-SQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFFDAEGN-------DID 122

  Fly   129 TEPDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVK 193
            ..       |||:..| |:                      ||||||:|.|||::||:::.||.|
Mouse   123 LN-------FGGLWGR-GV----------------------QKQDPPIERDLYLSLEDLFFGCTK 157

  Fly   194 KMKISRRIVQADG-SSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAM 257
            |:|||||::..|. ||..::|.|.|.::|||:.||::||:|||||.|..|||||:||:::|.|..
Mouse   158 KIKISRRVLNEDRYSSTIKDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPR 222

  Fly   258 FKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTVKRIQGYGLPFPKDTTR 322
            |:||..:|.:...:.|.:||.....:|.|:. |:|....:.:|:.|...|.:.|.|:|.|::.::
Mouse   223 FRREHDNLFFVYPIPLGKALTCCTVEVKTLD-DRLLNIPINDIVHPKYFKIVPGEGMPLPENPSK 286

  Fly   323 KGDLLVAFDIQFPEKLTAAQKEVLKDML 350
            ||||.:.||||||.:||..:|::|:..|
Mouse   287 KGDLFIFFDIQFPTRLTPQKKQMLRQAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 148/348 (43%)
DnaJ 4..65 CDD:278647 31/60 (52%)
DnaJ_C 174..338 CDD:199909 73/164 (45%)
Dnajb13NP_705755.2 DnaJ 1..312 CDD:223560 149/349 (43%)
DnaJ 4..65 CDD:278647 31/60 (52%)
DnaJ_C 138..302 CDD:199909 73/164 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.