DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnajb2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_006245338.1 Gene:Dnajb2 / 689593 RGDID:1591035 Length:324 Species:Rattus norvegicus


Alignment Length:362 Identity:107/362 - (29%)
Similarity:150/362 - (41%) Gaps:116/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            ||:||.:|::|:.|:|||||||.||::|||||  ....||.|||||||||||||||.|||:||:|
  Rat     4 YYEILDVPRSASPDDIKKAYRKKALQWHPDKNPDNKEFAEKKFKEVAEAYEVLSDKHKREIYDRY 68

  Fly    68 GEDGLKSGGTRNGGPSSN-------SFTYQFHGDPRATFAQFFGNSNPFASFFD----------M 115
            |.:||...|:   |||.:       .||:.|. .|...|.:|||:.:||:..||          .
  Rat    69 GREGLTGAGS---GPSRSETGGMEPGFTFTFR-SPEEVFREFFGSGDPFSELFDDLGAFSELQNQ 129

  Fly   116 GDNLFDKKVFDLDTEPDF-FSSPFGGIGSRHGLGSGFRP---SFRSHSFNVHTPFKKEQKQDPPV 176
            |..|         |.|.| |||.|.|..........|.|   :|||.|  ..|.|          
  Rat   130 GSRL---------TGPFFTFSSSFPGNSDFSSSSFSFSPGAGAFRSVS--TSTTF---------- 173

  Fly   177 EHDLYVTLEEIYHGCVKKMKISRRIVQADGSSRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGK 241
                           |:..:|:.|.:..:|..|.|.:          :.|...:....|      
  Rat   174 ---------------VQGRRITTRRIMENGQERVEVE----------EDGQLKSVSING------ 207

  Fly   242 IPADIVFIIRDKPHAMFKREGSDLRYTARLTLKQALCGVVFQVPTMSGDKLRISTMQEIIKPNTV 306
            :|.|:...:.     :.:||                     |.|:::..   :..||  ::|.:|
  Rat   208 VPDDLALGLE-----LSRRE---------------------QQPSVTPG---LGVMQ--VRPTSV 241

  Fly   307 KRIQGYGLPFPKDTTRKGDLLVAFDIQFPEKLTAAQK 343
            .|      |...|.:...|:.:|......|...:.||
  Rat   242 SR------PPDSDLSEDEDMQLAMAYSLSEMEASGQK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 107/362 (30%)
DnaJ 4..65 CDD:278647 41/61 (67%)
DnaJ_C 174..338 CDD:199909 24/163 (15%)
Dnajb2XP_006245338.1 DnaJ 3..>110 CDD:223560 59/109 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347699
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.