DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Samd13

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:248 Identity:70/248 - (28%)
Similarity:109/248 - (43%) Gaps:61/248 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAAN--AEDKFKEVAEAYEVLSDKSKREVYDK 66
            :|||:||:|:.|:..:||||:.:|||:.|||||....  ||:|||:|||||::|||..||:.||:
  Rat     3 NYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDYDR 67

  Fly    67 YGEDGLKSGGTRNGGPSSNSFTYQF-HGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTE 130
            ......|....|..|....::..:. ...||.||.....:.:.|:     ||.|           
  Rat    68 SRWSRTKEELIRGDGRDETNWEEEICSRRPRRTFQTVIEDEDLFS-----GDYL----------- 116

  Fly   131 PDFFSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTP--------FKKEQKQDPPVEHDLYV----- 182
               |:.|.  ..||.|          |.:|...||        |..::.:..|.:.:.:|     
  Rat   117 ---FTGPM--THSRRG----------SSNFFTVTPIIDTGFSTFVSQESKSSPDDSEAFVPYISH 166

  Fly   183 ---------TLEEIYHGCVKKMKISRRIVQADGSSRK--EEKFLAISIKPGWK 224
                     |..:|.:|   |..:::|:|:.....:|  .|:....:...|||
  Rat   167 GMGKFRLVTTCSQIMNG---KRVVTKRVVENIQGPKKIENERLFRWNPSRGWK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 70/248 (28%)
DnaJ 4..65 CDD:278647 34/62 (55%)
DnaJ_C 174..338 CDD:199909 13/67 (19%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 35/63 (56%)
DnaJ 3..66 CDD:278647 34/62 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347692
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.