DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and Dnaja2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_062768.1 Gene:Dnaja2 / 56445 MGIID:1931882 Length:412 Species:Mus musculus


Alignment Length:410 Identity:125/410 - (30%)
Similarity:187/410 - (45%) Gaps:129/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYGED 70
            |.|||:|..|:::|:||||||||..||||||  .||.|||||::.||||||:..|||:||:|||.
Mouse    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly    71 GLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDFFS 135
            ||:.|....||                                             :|   |.||
Mouse    73 GLREGSGGGGG---------------------------------------------MD---DIFS 89

  Fly   136 SPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRR 200
            ..|||     || .||..: :|.|.|       .:::...:.|.|.|:||::|:|...|:::|:.
Mouse    90 HIFGG-----GL-FGFMGN-QSRSRN-------GRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKN 140

  Fly   201 I--------------VQADGSSR------------------------------------------ 209
            :              ||...:.|                                          
Mouse   141 VLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKC 205

  Fly   210 ------KEEKFLAISIKPGWKSGTKVTFQKEGDQAPGKIPADIVFIIRDKPHAMFKREGSDLRYT 268
                  ||.|.|.:.:..|.|.|.::||..|.|||||..|.|||.::::|.|.:|:|:|:||..|
Mouse   206 EGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMT 270

  Fly   269 ARLTLKQALCGVVFQVPTMSGDKLRIS-TMQEIIKPNTVKRIQGYGLPFPKDTTRKGDLLVAFDI 332
            .::.|.:||||..|....:...::.:. ...::|:|..|:.::|.|:|..::...||||.:.||:
Mouse   271 YKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDV 335

  Fly   333 QFPEK--LTAAQKEVLKDML 350
            ||||.  :...:...|:|:|
Mouse   336 QFPENNWINPDKLSELEDLL 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 122/405 (30%)
DnaJ 4..65 CDD:278647 37/58 (64%)
DnaJ_C 174..338 CDD:199909 61/228 (27%)
Dnaja2NP_062768.1 PTZ00037 4..412 CDD:240236 125/410 (30%)
CXXCXGXG motif 143..150 0/6 (0%)
CXXCXGXG motif 159..166 1/6 (17%)
CXXCXGXG motif 186..193 0/6 (0%)
CXXCXGXG motif 202..209 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.