DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajb2

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001073462.1 Gene:dnajb2 / 561686 ZFINID:ZDB-GENE-061013-537 Length:389 Species:Danio rerio


Alignment Length:234 Identity:88/234 - (37%)
Similarity:121/234 - (51%) Gaps:37/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            |||.:||:.::|:.|:||||||||||::|||||  ....||.||||:|||||||||||||:.||:
Zfish     3 DYYDVLGVSRSASPDDIKKAYRKLALQWHPDKNPDNKEEAEKKFKEIAEAYEVLSDKSKRDDYDR 67

  Fly    67 YGEDGLKSGGTRNGGPSSN---SFTYQFHGDPRATFAQFFGNSNPFASFFD------------MG 116
            ||...:.|.|:.:.|...:   .||:.|. .|...|.:|||..:|||.|||            ..
Zfish    68 YGRSDMPSSGSGSSGSFPDDFPGFTFTFR-SPDEVFREFFGGQDPFADFFDDFPFGGMHSGFHSS 131

  Fly   117 DNLFDKKVFDL-DTEPDF--FSSPFGGIGSRHGLGSGFRPSFRSHSFNVH--------TPFKKEQ 170
            ..|...:.|.. ....||  |||..||:||..|      .:|:|.|.:..        |...:|.
Zfish   132 SRLGPSRFFSFPSANADFTSFSSSLGGMGSMGG------ANFKSVSTSTRVVNGKRLTTKKVREN 190

  Fly   171 KQD-PPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGSS 208
            .|: ..||.| .|....:.:|...:|.::..:.:.:.||
Zfish   191 GQERTEVEED-GVLKSVLINGVEDEMALALELSRREQSS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 88/234 (38%)
DnaJ 4..65 CDD:278647 41/62 (66%)
DnaJ_C 174..338 CDD:199909 8/35 (23%)
dnajb2NP_001073462.1 DnaJ 2..>108 CDD:223560 55/105 (52%)
DnaJ 3..66 CDD:278647 41/62 (66%)
UIM 269..285 CDD:280900
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589224
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.