DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajc18

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001107060.1 Gene:dnajc18 / 559928 ZFINID:ZDB-GENE-030131-8019 Length:407 Species:Danio rerio


Alignment Length:190 Identity:67/190 - (35%)
Similarity:90/190 - (47%) Gaps:59/190 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            :|:|:|||:||.|:|:::||||||||||:|||||.|..|.|.||.:..||.|||:..||:.||:|
Zfish   120 RDFYEILGVPKGASDEDLKKAYRKLALRFHPDKNCAPGATDAFKAIGNAYAVLSNPEKRQQYDEY 184

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPD 132
            |:.          ||:..|  .|....||..:|:                    .:.|..|.|||
Zfish   185 GDQ----------GPAETS--SQPSAQPRQAYAR--------------------HRSFTRDFEPD 217

  Fly   133 -----FFSSPFGG---IGSRHGLGSG-------FRPSFR------------SHSFNVHTP 165
                 .|:..|||   .|:.|...:|       ::|..|            |||.|..||
Zfish   218 ISPEELFNIFFGGRFPTGNIHVYTNGGASYAHYYQPRRRRPFERREEEVEESHSTNNFTP 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 67/190 (35%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 174..338 CDD:199909
dnajc18NP_001107060.1 DnaJ 121..182 CDD:278647 36/60 (60%)
DUF1977 299..399 CDD:286411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589196
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.