DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajc16

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_005166271.1 Gene:dnajc16 / 559762 ZFINID:ZDB-GENE-130530-683 Length:777 Species:Danio rerio


Alignment Length:224 Identity:60/224 - (26%)
Similarity:93/224 - (41%) Gaps:76/224 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKYG 68
            |.||:||:.::|:..||||.|::||..:||||||...|||.|.::.::||:|:::.||..||:||
Zfish    29 DPYKVLGVTRSASQAEIKKVYKRLAKEWHPDKNKNPEAEDMFIKITKSYEILTNEEKRASYDRYG 93

  Fly    69 EDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDF 133
            :.           ..:..:.::.||     |..|..|      |:      ||:         .|
Zfish    94 QT-----------DDTQPYGHRHHG-----FRHFHDN------FY------FDE---------SF 121

  Fly   134 FSSPFGGIGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKK---M 195
            |..||...|.|         .|....:.:|              .:.||  .|:.....|:   :
Zfish   122 FHFPFNNKGGR---------DFADSKYTLH--------------FNQYV--NEVVPDSFKRPYLI 161

  Fly   196 KISRRIVQADGSSRKEEKFLAISIKPGWK 224
            ||:           .:..|..|.|:|.||
Zfish   162 KIT-----------SDWCFSCIHIEPVWK 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 60/224 (27%)
DnaJ 4..65 CDD:278647 28/60 (47%)
DnaJ_C 174..338 CDD:199909 12/54 (22%)
dnajc16XP_005166271.1 DnaJ 29..90 CDD:278647 28/60 (47%)
TRX_DnaJ 133..242 CDD:239261 14/74 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.