DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajb14

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001016588.1 Gene:dnajb14 / 549342 XenbaseID:XB-GENE-952313 Length:375 Species:Xenopus tropicalis


Alignment Length:174 Identity:55/174 - (31%)
Similarity:82/174 - (47%) Gaps:42/174 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAANAEDKFKEVAEAYEVLSDKSKREVYDKY 67
            |.||::||:...|.::::|||||||||::|||||.|..|.:.||::..||.|||:..||:.||..
 Frog   105 KTYYEVLGVSTDAGEEDLKKAYRKLALKFHPDKNHAPGATEAFKKIGNAYAVLSNPEKRKQYDLT 169

  Fly    68 GEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEP- 131
            |.:.......||||       :.:|                              :.|:.|..| 
 Frog   170 GSEDQMQNNHRNGG-------FDYH------------------------------RGFEADITPE 197

  Fly   132 DFFSSPFGG---IGSRHGLGSGFRPSFRSHSFNVHTPFKKEQKQ 172
            |.|:..|||   .||.|...:| |..:..|..:.|:...:|.::
 Frog   198 DLFNMFFGGGFPSGSVHTFSNG-RARYSHHQHHHHSGHDREDER 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 55/174 (32%)
DnaJ 4..65 CDD:278647 30/60 (50%)
DnaJ_C 174..338 CDD:199909
dnajb14NP_001016588.1 FliS 6..>34 CDD:382133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
DnaJ_bact 107..>212 CDD:274090 46/141 (33%)
DUF1977 269..367 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.