DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajb6a

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001002353.1 Gene:dnajb6a / 436626 ZFINID:ZDB-GENE-040718-45 Length:316 Species:Danio rerio


Alignment Length:314 Identity:100/314 - (31%)
Similarity:136/314 - (43%) Gaps:98/314 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DYYKILGLPKTATDDEIKKAYRKLALRYHPDKN--KAANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            |||::||:.|||:.|:|||||||||||:|||||  ...:||.||||::||||||||.:||.:||:
Zfish     3 DYYQVLGVQKTASPDDIKKAYRKLALRWHPDKNPDNKEDAEKKFKELSEAYEVLSDANKRSLYDR 67

  Fly    67 YGEDGLKSGGTRNGGP----SSNSFTYQFHGDPRATFAQFFGNSNPFASFF---DMGDNLFDKK- 123
            ||::||..||  .||.    ....||::   :|...|.:|||..:|||.||   ..||:.|..: 
Zfish    68 YGKEGLTPGG--GGGREHHFGGGGFTFR---NPEDVFREFFGGQDPFADFFGADPFGDDFFGGRR 127

  Fly   124 ----------------------------------VFDLDTEP---------DFFSSPF---GGIG 142
                                              .||....|         .|.:|.|   ||.|
Zfish   128 HYHHHHQRGMSRSRTGGSFFGGFGGFPPFGAGFTSFDAGFTPFGHMGGGFTSFSTSSFGGGGGGG 192

  Fly   143 SRHGLGSGFRPSFRSHSFNVHTPFKKEQKQDPPVEHDLYVTLEEIYHGCVKKMKISRRIVQADGS 207
            ...|.|.|...||||.|  ..|.|...:|          :|.:.|:....::::     |:.||.
Zfish   193 GGGGGGGGGMGSFRSVS--TSTKFINGRK----------ITTKRIFENGQERVE-----VEEDGQ 240

  Fly   208 --------------------SRKEEKFLAISIKPGWKSGTKVTFQKEGDQAPGK 241
                                .|||....:.|......|......::|.::.|||
Zfish   241 LKSLTINGKAQDIGMLDCQRQRKELPDSSSSSSSSSHSARHSAQREEQNRTPGK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 100/314 (32%)
DnaJ 4..65 CDD:278647 41/62 (66%)
DnaJ_C 174..338 CDD:199909 14/88 (16%)
dnajb6aNP_001002353.1 DnaJ 3..66 CDD:278647 41/62 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.