DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and jdp

DIOPT Version :10

Sequence 1:NP_608586.2 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_651807.1 Gene:jdp / 43630 FlyBaseID:FBgn0027654 Length:195 Species:Drosophila melanogaster


Alignment Length:71 Identity:29/71 - (40%)
Similarity:46/71 - (64%) Gaps:1/71 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDKNKA-ANAEDKFKEVAEAYEVLSDKSKREVYDK 66
            :|:|.:|...:.::.::|:..|:.|||:||||||.. ..||.||:::.||.|.|.|..||.:|||
  Fly    16 EDFYGLLHCDENSSPEQIQAEYKVLALQYHPDKNSGDKEAEAKFQQLKEAKETLCDPEKRAIYDK 80

  Fly    67 YGEDGL 72
            :...|:
  Fly    81 WRNSGI 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_608586.2 DnaJ_bact 4..347 CDD:274090 29/70 (41%)
jdpNP_651807.1 DnaJ 17..79 CDD:395170 25/61 (41%)

Return to query results.
Submit another query.