DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and P58IPK

DIOPT Version :10

Sequence 1:NP_608586.2 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649916.1 Gene:P58IPK / 41161 FlyBaseID:FBgn0037718 Length:498 Species:Drosophila melanogaster


Alignment Length:113 Identity:44/113 - (38%)
Similarity:59/113 - (52%) Gaps:25/113 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDK---NKAANAEDKFKEVAEAYEVLSDKSKREVY 64
            :|||||||:.::|:..||.|||||.|.::|||.   .:...||.||.::|.|.|||:|..||..:
  Fly   395 RDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQF 459

  Fly    65 DKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASF 112
            |. |||.|.....:.||         |||:            :||..|
  Fly   460 DN-GEDPLDPESNQRGG---------FHGE------------HPFGHF 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_608586.2 DnaJ_bact 4..347 CDD:274090 44/112 (39%)
P58IPKNP_649916.1 TPR repeat 43..71 CDD:276809
LapB 47..284 CDD:442196
TPR repeat 76..106 CDD:276809
TPR repeat 111..139 CDD:276809
TPR repeat 190..220 CDD:276809
LapB 196..>378 CDD:442196
TPR repeat 225..253 CDD:276809
TPR repeat 309..337 CDD:276809
TPR repeat 341..371 CDD:276809
TPR repeat 376..399 CDD:276809 2/3 (67%)
PRK14278 395..>485 CDD:237654 43/111 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.