DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG5001 and P58IPK

DIOPT Version :9

Sequence 1:	NP_001245832.1	Gene:	CG5001 / 33308	FlyBaseID:	FBgn0031322	Length:	350	Species:	Drosophila melanogaster
Sequence 2:	NP_649916.1	Gene:	P58IPK / 41161	FlyBaseID:	FBgn0037718	Length:	498	Species:	Drosophila melanogaster

Alignment Length:	113	Identity:	44/113 - (38%)
Similarity:	59/113 - (52%)	Gaps:	25/113 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 KDYYKILGLPKTATDDEIKKAYRKLALRYHPDK---NKAANAEDKFKEVAEAYEVLSDKSKREVY 64
            :|||||||:.::|:..||.|||||.|.::|||.   .:...||.||.::|.|.|||:|..||..:
  Fly   395 RDYYKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEEKKVAEKKFIDIAAAKEVLTDPEKRRQF 459

  Fly    65 DKYGEDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASF 112
            |. |||.|.....:.||         |||:            :||..|
  Fly   460 DN-GEDPLDPESNQRGG---------FHGE------------HPFGHF 485

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG5001	NP_001245832.1	DnaJ	1..347	CDD:223560	44/113 (39%)
		DnaJ	4..65	CDD:278647	31/63 (49%)
		DnaJ_C	174..338	CDD:199909
P58IPK	NP_649916.1	TPR_11	42..108	CDD:290150
		TPR repeat	43..71	CDD:276809
		TPR repeat	76..106	CDD:276809
		TPR_11	78..142	CDD:290150
		TPR repeat	111..139	CDD:276809
		TPR_1	113..144	CDD:278916
		TPR_19	167..234	CDD:291240
		TPR repeat	190..220	CDD:276809
		TPR repeat	225..253	CDD:276809
		TPR repeat	309..337	CDD:276809
		TPR_11	312..373	CDD:290150
		TPR repeat	341..371	CDD:276809
		TPR repeat	376..399	CDD:276809	2/3 (67%)
		DnaJ	395..>485	CDD:223560	43/111 (39%)
		DnaJ	396..460	CDD:278647	31/63 (49%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910