DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and CG11035

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster


Alignment Length:214 Identity:55/214 - (25%)
Similarity:88/214 - (41%) Gaps:71/214 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 YYKILGLPKTATDDEIKKAYRKLALRYHPDKNKAA-NAEDKFKEVAEAYEVLSDKSKREVYDKYG 68
            :|..||:.:..|.:|||.||.||::.||||:|:.: ||..||:|:.:|||:|.:...|.:|||  
  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90

  Fly    69 EDGLKSGGTRNGGPSSNSFTYQFHGDPRATFAQFFGNSNPFASFFDMGDNLFDKKVFDLDTEPDF 133
                  |.....|               |.:||            |:.|  ..:.|.:.|.|..|
  Fly    91 ------GIVHTAG---------------AQYAQ------------DVHD--VAEPVVEDDAETKF 120

  Fly   134 FSSPFGGIGSRHGLGSGFRPSF------RSH---SFNVHTPFKKEQKQDPPVEHDLYVTLEEIYH 189
            :.|.|.  .||....:|..|.:      |:|   ||        :::|....::|          
  Fly   121 YKSRFQ--KSRVSDSAGRTPIYDFDEWSRNHYGKSF--------DRRQAAQAKYD---------- 165

  Fly   190 GCVKKMKISRRIVQADGSS 208
                ::|:.|...:..|.:
  Fly   166 ----RIKVQRETNRISGQT 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 55/214 (26%)
DnaJ 4..65 CDD:278647 26/60 (43%)
DnaJ_C 174..338 CDD:199909 4/35 (11%)
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/60 (43%)
DnaJ 27..89 CDD:278647 26/60 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.