DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5001 and dnajc5gb

DIOPT Version :9

Sequence 1:NP_001245832.1 Gene:CG5001 / 33308 FlyBaseID:FBgn0031322 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_005158621.1 Gene:dnajc5gb / 393371 ZFINID:ZDB-GENE-040426-1238 Length:212 Species:Danio rerio


Alignment Length:72 Identity:38/72 - (52%)
Similarity:54/72 - (75%) Gaps:1/72 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDYYKILGLPKTATDDEIKKAYRKLALRYHPDKN-KAANAEDKFKEVAEAYEVLSDKSKREVYD 65
            |:..|:.|||.|.|:.::||||||||||::||||| ....|.:||||:..|..:|:|::||::||
Zfish    15 GESLYQTLGLQKGASSEDIKKAYRKLALKHHPDKNPNNPEAAEKFKEINNANSILNDETKRQIYD 79

  Fly    66 KYGEDGL 72
            :||..||
Zfish    80 EYGSMGL 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5001NP_001245832.1 DnaJ 1..347 CDD:223560 38/72 (53%)
DnaJ 4..65 CDD:278647 31/61 (51%)
DnaJ_C 174..338 CDD:199909
dnajc5gbXP_005158621.1 DnaJ 14..>86 CDD:223560 36/70 (51%)
DnaJ 17..79 CDD:278647 31/61 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.